SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000305502 from Homo sapiens 69_37

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000305502
Domain Number 1 Region: 464-523
Classification Level Classification E-value
Superfamily UBA-like 1.4e-19
Family CUE domain 0.0000543
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000305502   Gene: ENSG00000100325   Transcript: ENST00000307790
Sequence length 757
Comment pep:known chromosome:GRCh37:22:30184597:30234263:-1 gene:ENSG00000100325 transcript:ENST00000307790 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPALPLDQLQITHKDPKTGKLRTSPALHPEQKADRYFVLYKPPPKDNIPALVEEYLERAT
FVANDLDWLLALPHDKFWCQVIFDETLQKCLDSYLRYVPRKFDEGVASAPEVVDMQKRLH
RSVFLTFLRMSTHKESKDHFISPSAFGEILYNNFLFDIPKILDLCVLFGKGNSPLLQKMI
GNIFTQQPSYYSDLDETLPTILQVFSNILQHCGLQGDGANTTPQKLEERGRLTPSDMPLL
ELKDIVLYLCDTCTTLWAFLDIFPLACQTFQKHDFCYRLASFYEAAIPEMESAIKKRRLE
DSKLLGDLWQRLSHSRKKLMEIFHIILNQICLLPILESSCDNIQGFIEEFLQIFSSLLQE
KRFLRDYDALFPVAEDISLLQQASSVLDETRTAYILQAVESAWEGVDRRKATDAKDPSVI
EEPNGEPNGVTVTAEAVSQASSHPENSEEEECMGAAAAVGPAMCGVELDSLISQVKDLLP
DLGEGFILACLEYYHYDPEQVINNILEERLAPTLSQLDRNLDREMKPDPTPLLTSRHNVF
QNDEFDVFSRDSVDLSRVHKGKSTRKEENTRSLLNDKRAVAAQRQRYEQYSVVVEEVPLQ
PGESLPYHSVYYEDEYDDTYDGNQVGANDADSDDELISRRPFTIPQVLRTKVPREGQEED
DDDEEDDADEEAPKPDHFVQDPAVLREKAEARRMAFLAKKGYRHDSSTAVAGSPRGHGQS
RETTQERRKKEANKATRANHNRRTMADRKRSKGMIPS
Download sequence
Identical sequences A0A024R1F9 Q9H1I8
ENSP00000305502 ENSP00000380877 gi|20270253|ref|NP_115580.2| ENSP00000305502 ENSP00000305502 ENSP00000380877 NP_115580.2.87134 NP_115580.2.92137 XP_005261832.1.92137 XP_016884487.1.92137 XP_016884488.1.92137 XP_016884489.1.92137 NYSGRC-20270253 9606.ENSP00000305502

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]