SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000306844 from Homo sapiens 69_37

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000306844
Domain Number 1 Region: 33-498
Classification Level Classification E-value
Superfamily Sema domain 1.2e-167
Family Sema domain 0.00000000148
Further Details:      
 
Domain Number 2 Region: 500-548
Classification Level Classification E-value
Superfamily Plexin repeat 0.0000000000017
Family Plexin repeat 0.0011
Further Details:      
 
Domain Number 3 Region: 559-631
Classification Level Classification E-value
Superfamily Immunoglobulin 0.00000000119
Family I set domains 0.049
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000306844   Gene: ENSG00000168758   Transcript: ENST00000305476
Sequence length 833
Comment pep:known chromosome:GRCh37:2:97525453:97535708:-1 gene:ENSG00000168758 transcript:ENST00000305476 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAPHWAVWLLAARLWGLGIGAEVWWNLVPRKTVSSGELATVVRRFSQTGIQDFLTLTLTE
PTGLLYVGAREALFAFSMEALELQGAISWEAPVEKKTECIQKGKNNQTECFNFIRFLQPY
NASHLYVCGTYAFQPKCTYVNMLTFTLEHGEFEDGKGKCPYDPAKGHAGLLVDGELYSAT
LNNFLGTEPIILRNMGPHHSMKTEYLAFWLNEPHFVGSAYVPESVGSFTGDDDKVYFFFR
ERAVESDCYAEQVVARVARVCKGDMGGARTLQRKWTTFLKARLACSAPNWQLYFNQLQAM
HTLQDTSWHNTTFFGVFQAQWGDMYLSAICEYQLEEIQRVFEGPYKEYHEEAQKWDRYTD
PVPSPRPGSCINNWHRRHGYTSSLELPDNILNFVKKHPLMEEQVGPRWSRPLLVKKGTNF
THLVADRVTGLDGATYTVLFIGTGDGWLLKAVSLGPWVHLIEELQLFDQEPMRSLVLSQS
KKLLFAGSRSQLVQLPVADCMKYRSCADCVLARDPYCAWSVNTSRCVAVGGHSGSLLIQH
VMTSDTSGICNLRGSKKVRPTPKNITVVAGTDLVLPCHLSSNLAHARWTFGGRDLPAEQP
GSFLYDARLQALVVMAAQPRHAGAYHCFSEEQGARLAAEGYLVAVVAGPSVTLEARAPLE
NLGLVWLAVVALGAVCLVLLLLVLSLRRRLREELEKGAKATERTLVYPLELPKEPTSPPF
RPCPEPDEKLWDPVGYYYSDGSLKIVPGHARCQPGGGPPSPPPGIPGQPLPSPTRLHLGG
GRNSNANGYVRLQLGGEDRGGLGHPLPELADELRRKLQQRQPLPDSNPEESSV
Download sequence
Identical sequences Q9C0C4
ENSP00000306844 gi|157388902|ref|NP_060259.4| NYSGRC-IgSF-SEM4C_HUMAN ENSP00000306844 NP_060259.4.87134 NP_060259.4.92137 XP_011509680.1.92137 XP_011509681.1.92137 XP_011509682.1.92137 XP_011509683.1.92137 XP_011509684.1.92137 XP_011509685.1.92137 9606.ENSP00000306844 ENSP00000306844

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]