SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000307014 from Homo sapiens 69_37

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000307014
Domain Number 1 Region: 363-440
Classification Level Classification E-value
Superfamily Intermediate filament protein, coiled coil region 1.03e-23
Family Intermediate filament protein, coiled coil region 0.00041
Further Details:      
 
Domain Number 2 Region: 131-165
Classification Level Classification E-value
Superfamily Intermediate filament protein, coiled coil region 0.0000000000575
Family Intermediate filament protein, coiled coil region 0.0017
Further Details:      
 
Domain Number 3 Region: 172-241
Classification Level Classification E-value
Superfamily Intermediate filament protein, coiled coil region 0.000000105
Family Intermediate filament protein, coiled coil region 0.0086
Further Details:      
 
Weak hits

Sequence:  ENSP00000307014
Domain Number - Region: 271-362
Classification Level Classification E-value
Superfamily Prefoldin 0.0497
Family Prefoldin 0.016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000307014   Gene: ENSG00000186049   Transcript: ENST00000305748
Sequence length 540
Comment pep:known chromosome:GRCh37:12:53001354:53012343:-1 gene:ENSG00000186049 transcript:ENST00000305748 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSRQFTYKSGAAAKGGFSGCSAVLSGGSSSSYRAGGKGLSGGFSSRSLYSLGGARSISFN
VASGSGWAGGYGFGRGRASGFAGSMFGSVALGSVCPSLCPPGGIHQVTINKSLLAPLNVE
LDPEIQKVRAQEREQIKVLNNKFASFIDKVRFLEQQNQVLETKWELLQQLDLNNCKNNLE
PILEGYISNLRKQLETLSGDRVRLDSELRSVREVVEDYKKRYEEEINKRTTAENEFVVLK
KDVDAAYTSKVELQAKVDALDGEIKFFKCLYEGETAQIQSHISDTSIILSMDNNRNLDLD
SIIAEVRAQYEEIARKSKAEAEALYQTKFQELQLAAGRHGDDLKHTKNEISELTRLIQRL
RSEIESVKKQCANLETAIADAEQRGDCALKDARAKLDELEGALQQAKEELARMLREYQEL
LSVKLSLDIEIATYRKLLEGEECRMSGEYTNSVSISVINSSMAGMAGTGAGFGFSNAGTY
GYWPSSVSGGYSMLPGGCVTGSGNCSPRGEARTRLGSASEFRDSQGKTLALSSPTKKTMR
Download sequence
Identical sequences Q86Y46
ENSP00000307014 NP_778238.1.87134 NP_778238.1.92137 gi|28173564|ref|NP_778238.1| 9606.ENSP00000307014 ENSP00000307014 ENSP00000307014

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]