SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSP00000309871 from Homo sapiens 69_37

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000309871
Domain Number 1 Region: 358-540
Classification Level Classification E-value
Superfamily GTPase activation domain, GAP 2.35e-48
Family BCR-homology GTPase activation domain (BH-domain) 0.0001
Further Details:      
 
Domain Number 2 Region: 280-337
Classification Level Classification E-value
Superfamily Cysteine-rich domain 0.000000000000907
Family Protein kinase cysteine-rich domain (cys2, phorbol-binding domain) 0.01
Further Details:      
 
Weak hits

Sequence:  ENSP00000309871
Domain Number - Region: 28-104
Classification Level Classification E-value
Superfamily Tropomyosin 0.0634
Family Tropomyosin 0.0075
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000309871   Gene: ENSG00000161800   Transcript: ENST00000312377
Sequence length 632
Comment pep:known chromosome:GRCh37:12:50382945:50419244:-1 gene:ENSG00000161800 transcript:ENST00000312377 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDTMMLNVRNLFEQLVRRVEILSEGNEVQFIQLAKDFEDFRKKWQRTDHELGKYKDLLMK
AETERSALDVKLKHARNQVDVEIKRRQRAEADCEKLERQIQLIREMLMCDTSGSIQLSEE
QKSALAFLNRGQPSSSNAGNKRLSTIDESGSILSDISFDKTDESLDWDSSLVKTFKLKKR
EKRRSTSRQFVDGPPGPVKKTRSIGSAVDQGNESIVAKTTVTVPNDGGPIEAVSTIETVP
YWTRSRRKTGTLQPWNSDSTLNSRQLEPRTETDSVGTPQSNGGMRLHDFVSKTVIKPESC
VPCGKRIKFGKLSLKCRDCRVVSHPECRDRCPLPCIPTLIGTPVKIGEGMLADFVSQTSP
MIPSIVVHCVNEIEQRGLTETGLYRISGCDRTVKELKEKFLRVKTVPLLSKVDDIHAICS
LLKDFLRNLKEPLLTFRLNRAFMEAAEITDEDNSIAAMYQAVGELPQANRDTLAFLMIHL
QRVAQSPHTKMDVANLAKVFGPTIVAHAVPNPDPVTMLQDIKRQPKVVERLLSLPLEYWS
QFMMVEQENIDPLHVIENSNAFSTPQTPDIKVSLLGPVTTPEHQLLKTPSSSSLSQRVRS
TLTKNTPRFGSKSKSATNLGRQGNFFASPMLK
Download sequence
Identical sequences A0A024R136 Q9H0H5
ENSP00000309871 ENSP00000404190 ENSP00000404808 ENSP00000449370 ENSP00000449374 9606.ENSP00000309871 gi|186910300|ref|NP_001119575.1| gi|186910302|ref|NP_001119576.1| gi|21361397|ref|NP_037409.2| NP_001119575.1.87134 NP_001119575.1.92137 NP_001119576.1.87134 NP_001119576.1.92137 NP_001306928.1.87134 NP_001306928.1.92137 NP_001306929.1.87134 NP_001306929.1.92137 NP_001306930.1.87134 NP_001306930.1.92137 NP_001306931.1.87134 NP_001306931.1.92137 NP_001306932.1.87134 NP_001306932.1.92137 NP_001306933.1.87134 NP_001306933.1.92137 NP_037409.2.87134 NP_037409.2.92137 XP_006719422.1.92137 XP_011536540.1.92137 XP_016874709.1.92137 ENSP00000309871 ENSP00000404190 ENSP00000404808 ENSP00000413241 ENSP00000449370 ENSP00000449374 ENSP00000309871

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]