SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000310491 from Homo sapiens 69_37

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000310491
Domain Number 1 Region: 237-431
Classification Level Classification E-value
Superfamily GTPase activation domain, GAP 1.08e-54
Family BCR-homology GTPase activation domain (BH-domain) 0.00000000575
Further Details:      
 
Domain Number 2 Region: 64-204
Classification Level Classification E-value
Superfamily CRAL/TRIO domain 2.35e-24
Family CRAL/TRIO domain 0.005
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000310491   Gene: ENSG00000175220   Transcript: ENST00000311956
Sequence length 439
Comment pep:known chromosome:GRCh37:11:46698630:46722149:-1 gene:ENSG00000175220 transcript:ENST00000311956 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDPLSELQDDLTLDDTSEALNQLKLASIDEKNWPSDEMPDFPKSDDSKSSSPELVTHLKW
DDPYYDIARHQIVEVAGDDKYGRKIIVFSACRMPPSHQLDHSKLLGYLKHTLDQYVESDY
TLLYLHHGLTSDNKPSLSWLRDAYREFDRKYKKNIKALYIVHPTMFIKTLLILFKPLISF
KFGQKIFYVNYLSELSEHVKLEQLGIPRQVLKYDDFLKSTQKSPATAPKPMPPRPPLPNQ
QFGVSLQHLQEKNPEQEPIPIVLRETVAYLQAHALTTEGIFRRSANTQVVREVQQKYNMG
LPVDFDQYNELHLPAVILKTFLRELPEPLLTFDLYPHVVGFLNIDESQRVPATLQVLQTL
PEENYQVLRFLTAFLVQISAHSDQNKMTNTNLAVVFGPNLLWAKDAAITLKAINPINTFT
KFLLDHQGELFPSPDPSGL
Download sequence
Identical sequences Q07960
9606.ENSP00000310491 ENSP00000310491 NP_004299.1.87134 NP_004299.1.92137 XP_011518397.1.92137 gi|4757766|ref|NP_004299.1| HR4582 ENSP00000310491 ENSP00000310491

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]