SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000310573 from Homo sapiens 69_37

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000310573
Domain Number 1 Region: 311-389
Classification Level Classification E-value
Superfamily Intermediate filament protein, coiled coil region 2.79e-20
Family Intermediate filament protein, coiled coil region 0.00097
Further Details:      
 
Domain Number 2 Region: 77-111
Classification Level Classification E-value
Superfamily Intermediate filament protein, coiled coil region 0.0000000288
Family Intermediate filament protein, coiled coil region 0.0024
Further Details:      
 
Weak hits

Sequence:  ENSP00000310573
Domain Number - Region: 125-224
Classification Level Classification E-value
Superfamily Myosin rod fragments 0.0139
Family Myosin rod fragments 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000310573   Gene: ENSG00000204897   Transcript: ENST00000312150
Sequence length 450
Comment pep:known chromosome:GRCh37:17:38904273:38911584:-1 gene:ENSG00000204897 transcript:ENST00000312150 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSLRLSSASRRSCPRPTTGSLRLYGGGTSFGTGNSCGISGIGSGFSSAFGGSSSGGNTGG
GNPCAGFTVNERGLLSGNEKVTMQNLNDRLASYLDSVHALEEANADLEQKIKGWYEKFGP
GSCRGLDHDYSRYFPIIDDLKNQIIASTTSNANAVLQIDNARLTADDFRLKYENELALHQ
SVEADVNGLRRVLDEITLCRTDLEIQYETLSEEMTYLKKNHKEEMQVLQCAAGGNVNVEM
NAAPGVDLTVLLNNMRAEYEALAEQNRRDAEAWFNEKSASLQQQISEDVGATTSARNELT
EMKRTLQTLEIELQSLLATKHSLECSLTETESNYCAQLAQIQAQIGALEEQLHQVRTETE
GQKLEYEQLLDIKLHLEKEIETYCLLIGGDDGACKSGGYKSKDYGSGNVGSQVKDPAKAI
VVKKVLEEVDQRSKILTTRLHSLEEKSQSN
Download sequence
Identical sequences Q7Z3Z0
NP_853512.1.87134 NP_853512.1.92137 9606.ENSP00000310573 NYSGRC-31559829 ENSP00000310573 gi|31559829|ref|NP_853512.1| ENSP00000310573 ENSP00000310573

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]