SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000313046 from Homo sapiens 69_37

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000313046
Domain Number 1 Region: 405-461
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.0000000000000405
Family TSP-1 type 1 repeat 0.00033
Further Details:      
 
Domain Number 2 Region: 466-516
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.000000000000746
Family TSP-1 type 1 repeat 0.00074
Further Details:      
 
Domain Number 3 Region: 519-574
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.00000000000405
Family TSP-1 type 1 repeat 0.00039
Further Details:      
 
Domain Number 4 Region: 353-402
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.0000000000327
Family TSP-1 type 1 repeat 0.0011
Further Details:      
 
Domain Number 5 Region: 262-310
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.00000000017
Family TSP-1 type 1 repeat 0.0013
Further Details:      
 
Weak hits

Sequence:  ENSP00000313046
Domain Number - Region: 591-638
Classification Level Classification E-value
Superfamily Hormone receptor domain 0.000314
Family Hormone receptor domain 0.006
Further Details:      
 
Domain Number - Region: 946-1122
Classification Level Classification E-value
Superfamily Family A G protein-coupled receptor-like 0.00087
Family Rhodopsin-like 0.034
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000313046   Gene: ENSG00000181790   Transcript: ENST00000323289
Sequence length 1584
Comment pep:known chromosome:GRCh37:8:143545377:143626346:1 gene:ENSG00000181790 transcript:ENST00000323289 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MRGQAAAPGPVWILAPLLLLLLLLGRRARAAAGADAGPGPEPCATLVQGKFFGYFSAAAV
FPANASRCSWTLRNPDPRRYTLYMKVAKAPVPCSGPGRVRTYQFDSFLESTRTYLGVESF
DEVLRLCDPSAPLAFLQASKQFLQMRRQQPPQHDGLRPRAGPPGPTDDFSVEYLVVGNRN
PSRAACQMLCRWLDACLAGSRSSHPCGIMQTPCACLGGEAGGPAAGPLAPRGDVCLRDAV
AGGPENCLTSLTQDRGGHGATGGWKLWSLWGECTRDCGGGLQTRTRTCLPAPGVEGGGCE
GVLEEGRQCNREACGPAGRTSSRSQSLRSTDARRREELGDELQQFGFPAPQTGDPAAEEW
SPWSVCSSTCGEGWQTRTRFCVSSSYSTQCSGPLREQRLCNNSAVCPVHGAWDEWSPWSL
CSSTCGRGFRDRTRTCRPPQFGGNPCEGPEKQTKFCNIALCPGRAVDGNWNEWSSWSACS
ASCSQGRQQRTRECNGPSYGGAECQGHWVETRDCFLQQCPVDGKWQAWASWGSCSVTCGA
GSQRRERVCSGPFFGGAACQGPQDEYRQCGTQRCPEPHEICDEDNFGAVIWKETPAGEVA
AVRCPRNATGLILRRCELDEEGIAYWEPPTYIRCVSIDYRNIQMMTREHLAKAQRGLPGE
GVSEVIQTLVEISQDGTSYSGDLLSTIDVLRNMTEIFRRAYYSPTPGDVQNFVQILSNLL
AEENRDKWEEAQLAGPNAKELFRLVEDFVDVIGFRMKDLRDAYQVTDNLVLSIHKLPASG
ATDISFPMKGWRATGDWAKVPEDRVTVSKSVFSTGLTEADEASVFVVGTVLYRNLGSFLA
LQRNTTVLNSKVISVTVKPPPRSLRTPLEIEFAHMYNGTTNQTCILWDETDVPSSSAPPQ
LGPWSWRGCRTVPLDALRTRCLCDRLSTFAILAQLSADANMEKATLPSVTLIVGCGVSSL
TLLMLVIIYVSVWRYIRSERSVILINFCLSIISSNALILIGQTQTRNKVVCTLVAAFLHF
FFLSSFCWVLTEAWQSYMAVTGHLRNRLIRKRFLCLGWGLPALVVAISVGFTKAKGYSTM
NYCWLSLEGGLLYAFVGPAAAVVLVNMVIGILVFNKLVSKDGITDKKLKERAGASLWSSC
VVLPLLALTWMSAVLAVTDRRSALFQILFAVFDSLEGFVIVMVHCILRREVQDAVKCRVV
DRQEEGNGDSGGSFQNGHAQLMTDFEKDVDLACRSVLNKDIAACRTATITGTLKRPSLPE
EEKLKLAHAKGPPTNFNSLPANVSKLHLHGSPRYPGGPLPDFPNHSLTLKRDKAPKSSFV
GDGDIFKKLDSELSRAQEKALDTSYVILPTATATLRPKPKEEPKYSIHIDQMPQTRLIHL
STAPEASLPARSPPSRQPPSGGPPEAPPAQPPPPPPPPPPPPQQPLPPPPNLEPAPPSLG
DPGEPAAHPGPSTGPSTKNENVATLSVSSLERRKSRYAELDFEKIMHTRKRHQDMFQDLN
RKLQHAAEKDKEVLGPDSKPEKQQTPNKRPWESLRKAHGTPTWVKKELEPLQPSPLELRS
VEWERSGATIPLVGQDIIDLQTEV
Download sequence
Identical sequences O14514
9606.ENSP00000313046 gi|111118994|ref|NP_001693.2| ENSP00000313046 NYSGXRC-13038a ENSP00000313046 ENSP00000430945 NP_001693.2.87134 NP_001693.2.92137 XP_011515501.1.92137 ENSP00000313046 ENSP00000430945

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]