SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000315664 from Homo sapiens 69_37

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000315664
Domain Number 1 Region: 36-123
Classification Level Classification E-value
Superfamily Retrovirus capsid dimerization domain-like 4.35e-36
Family SCAN domain 0.0000526
Further Details:      
 
Domain Number 2 Region: 444-501
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 6.8e-22
Family Classic zinc finger, C2H2 0.0079
Further Details:      
 
Domain Number 3 Region: 486-538
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.65e-21
Family Classic zinc finger, C2H2 0.0073
Further Details:      
 
Domain Number 4 Region: 408-458
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000000000134
Family Classic zinc finger, C2H2 0.0098
Further Details:      
 
Domain Number 5 Region: 222-265
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 0.0000000405
Family KRAB domain (Kruppel-associated box) 0.0037
Further Details:      
 
Weak hits

Sequence:  ENSP00000315664
Domain Number - Region: 332-352
Classification Level Classification E-value
Superfamily TTHA1013/TTHA0281-like 0.0183
Family TTHA0281-like 0.046
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000315664   Gene: ENSG00000154957   Transcript: ENST00000322748
Sequence length 549
Comment pep:known chromosome:GRCh37:17:11880762:11900689:-1 gene:ENSG00000154957 transcript:ENST00000322748 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPVDLGQALGLLPSLAKAEDSQFSESDAALQEELSSPETARQLFRQFRYQVMSGPHETLK
QLRKLCFQWLQPEVHTKEQILEILMLEQFLTILPGEIQMWVRKQCPGSGEEAVTLVESLK
GDPQRLWQWISIQVLGQDILSEKMESPSCQVGEVEPHLEVVPQELGLENSSSGPGELLSH
IVKEESDTEAELALAASQPARLEERLIRDQDLGASLLPAAPQEQWRQLDSTQKEQYWDLM
LETYGKMVSGAGISHPKSDLTNSIEFGEELAGIYLHVNEKIPRPTCIGDRQENDKENLNL
ENHRDQELLHASCQASGEVPSQASLRGFFTEDEPGCFGEGENLPEALQNIQDEGTGEQLS
PQERISEKQLGQHLPNPHSGEMSTMWLEEKRETSQKGQPRAPMAQKLPTCRECGKTFYRN
SQLIFHQRTHTGETYFQCTICKKAFLRSSDFVKHQRTHTGEKPCKCDYCGKGFSDFSGLR
HHEKIHTGEKPYKCPICEKSFIQRSNFNRHQRVHTGEKPYKCSHCGKSFSWSSSLDKHQR
SHLGKKPFQ
Download sequence
Identical sequences P17022
gi|56118254|ref|NP_653281.2| ENSP00000315664 ENSP00000462296 ENSP00000463471 ENSP00000315664 ENSP00000463471 NP_001290210.1.87134 NP_001290210.1.92137 NP_653281.2.87134 NP_653281.2.92137 XP_011522304.1.92137 XP_016880495.1.92137 XP_016880496.1.92137 ENSP00000315664 9606.ENSP00000315664

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]