SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000317425 from Homo sapiens 69_37

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000317425
Domain Number 1 Region: 504-820
Classification Level Classification E-value
Superfamily Ribonuclease H-like 1.11e-91
Family PIWI domain 0.041
Further Details:      
 
Domain Number 2 Region: 223-389
Classification Level Classification E-value
Superfamily PAZ domain 6.28e-62
Family PAZ domain 0.0000000882
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000317425   Gene: ENSG00000126070   Transcript: ENST00000324350
Sequence length 860
Comment pep:known chromosome:GRCh37:1:36396319:36449010:1 gene:ENSG00000126070 transcript:ENST00000324350 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEIGSAGPAGAQPLLMVPRRPGYGTMGKPIKLLANCFQVEIPKIDVYLYEVDIKPDKCPR
RVNREVVDSMVQHFKVTIFGDRRPVYDGKRSLYTANPLPVATTGVDLDVTLPGEGGKDRP
FKVSIKFVSRVSWHLLHEVLTGRTLPEPLELDKPISTNPVHAVDVVLRHLPSMKYTPVGR
SFFSAPEGYDHPLGGGREVWFGFHQSVRPAMWKMMLNIDVSATAFYKAQPVIQFMCEVLD
IHNIDEQPRPLTDSHRVKFTKEIKGLKVEVTHCGTMRRKYRVCNVTRRPASHQTFPLQLE
NGQTVERTVAQYFREKYTLQLKYPHLPCLQVGQEQKHTYLPLEVCNIVAGQRCIKKLTDN
QTSTMIKATARSAPDRQEEISRLVRSANYETDPFVQEFQFKVRDEMAHVTGRVLPAPMLQ
YGGRNRTVATPSHGVWDMRGKQFHTGVEIKMWAIACFATQRQCREEILKGFTDQLRKISK
DAGMPIQGQPCFCKYAQGADSVEPMFRHLKNTYSGLQLIIVILPGKTPVYAEVKRVGDTL
LGMATQCVQVKNVIKTSPQTLSNLCLKINVKLGGINNILVPHQRPSVFQQPVIFLGADVT
HPPAGDGKKPSIAAVVGSMDAHPSRYCATVRVQRPRQEIIQDLASMVRELLIQFYKSTRF
KPTRIIFYRDGVSEGQFRQVLYYELLAIREACISLEKDYQPGITYIVVQKRHHTRLFCAD
RTERVGRSGNIPAGTTVDTDITHPYEFDFYLCSHAGIQGTSRPSHYHVLWDDNCFTADEL
QLLTYQLCHTYVRCTRSVSIPAPAYYAHLVAFRARYHLVDKEHDSAEGSHVSGQSNGRDP
QALAKAVQIHQDTLRTMYFA
Download sequence
Identical sequences A0A096MU34 A0A0D9S7T2 A0A2K5F5V5 A0A2K5ISW2 A0A2K5LE75 A0A2K5RWN5 A0A2K5VAJ3 A0A2K5XX60 A0A2K6D983 A0A2K6MY99 A0A2K6R9H7 A0A2K6U612 G3RD28 H2N805 H2PYM8 H9Z073 Q9H9G7
NP_079128.2.87134 NP_079128.2.92137 XP_002811103.1.23681 XP_003812629.1.60992 XP_003937562.1.74449 XP_005270632.1.92137 XP_005544039.1.63531 XP_007977613.1.81039 XP_009451993.1.37143 XP_010358714.1.97406 XP_011761719.1.29376 XP_011810719.1.43180 XP_011844379.1.47321 XP_011934886.1.92194 XP_012295230.1.9421 XP_014990763.1.72884 XP_014990770.1.72884 XP_016814612.1.37143 XP_016856012.1.92137 XP_017356566.1.71028 XP_017739969.1.44346 XP_018870800.1.27298 ENSPPYP00000001788 9598.ENSPTRP00000000933 9600.ENSPPYP00000001788 9606.ENSP00000362287 ENSPTRP00000000933 ENSP00000317425 ENSP00000362287 gi|29294647|ref|NP_079128.2| ENSPANP00000003331 ENSPPYP00000001788 ENSP00000362287 ENSPTRP00000000933

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]