SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000317790 from Homo sapiens 69_37

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000317790
Domain Number 1 Region: 38-280
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 2.66e-71
Family Calponin-homology domain, CH-domain 0.0000184
Further Details:      
 
Domain Number 2 Region: 1263-1417
Classification Level Classification E-value
Superfamily Spectrin repeat 3.47e-29
Family Spectrin repeat 0.00099
Further Details:      
 
Domain Number 3 Region: 299-420
Classification Level Classification E-value
Superfamily Spectrin repeat 3.53e-28
Family Spectrin repeat 0.00036
Further Details:      
 
Domain Number 4 Region: 1574-1709
Classification Level Classification E-value
Superfamily Spectrin repeat 2.72e-26
Family Spectrin repeat 0.00099
Further Details:      
 
Domain Number 5 Region: 2315-2467
Classification Level Classification E-value
Superfamily Spectrin repeat 7.86e-26
Family Spectrin repeat 0.0013
Further Details:      
 
Domain Number 6 Region: 2844-2992
Classification Level Classification E-value
Superfamily Spectrin repeat 3.93e-25
Family Spectrin repeat 0.00034
Further Details:      
 
Domain Number 7 Region: 2525-2680
Classification Level Classification E-value
Superfamily Spectrin repeat 1.23e-24
Family Spectrin repeat 0.0021
Further Details:      
 
Domain Number 8 Region: 2952-3103
Classification Level Classification E-value
Superfamily Spectrin repeat 1.8e-23
Family Spectrin repeat 0.0021
Further Details:      
 
Domain Number 9 Region: 2738-2890
Classification Level Classification E-value
Superfamily Spectrin repeat 1.92e-23
Family Spectrin repeat 0.0021
Further Details:      
 
Domain Number 10 Region: 2117-2253
Classification Level Classification E-value
Superfamily Spectrin repeat 2.76e-23
Family Spectrin repeat 0.0011
Further Details:      
 
Domain Number 11 Region: 1699-1833
Classification Level Classification E-value
Superfamily Spectrin repeat 1.44e-21
Family Spectrin repeat 0.0015
Further Details:      
 
Domain Number 12 Region: 3527-3639
Classification Level Classification E-value
Superfamily PH domain-like 3.64e-20
Family Pleckstrin-homology domain (PH domain) 0.0046
Further Details:      
 
Domain Number 13 Region: 1477-1611
Classification Level Classification E-value
Superfamily Spectrin repeat 3.99e-20
Family Spectrin repeat 0.0008
Further Details:      
 
Domain Number 14 Region: 3289-3415
Classification Level Classification E-value
Superfamily Spectrin repeat 3.48e-19
Family Spectrin repeat 0.0016
Further Details:      
 
Domain Number 15 Region: 631-744
Classification Level Classification E-value
Superfamily Spectrin repeat 2.04e-18
Family Spectrin repeat 0.00092
Further Details:      
 
Domain Number 16 Region: 1052-1206
Classification Level Classification E-value
Superfamily Spectrin repeat 2.06e-18
Family Spectrin repeat 0.0017
Further Details:      
 
Domain Number 17 Region: 1891-2046
Classification Level Classification E-value
Superfamily Spectrin repeat 3.82e-17
Family Spectrin repeat 0.0027
Further Details:      
 
Domain Number 18 Region: 3162-3284
Classification Level Classification E-value
Superfamily Spectrin repeat 1.17e-16
Family Spectrin repeat 0.0027
Further Details:      
 
Domain Number 19 Region: 862-987
Classification Level Classification E-value
Superfamily Spectrin repeat 6e-16
Family Spectrin repeat 0.0065
Further Details:      
 
Domain Number 20 Region: 748-810,854-895
Classification Level Classification E-value
Superfamily Spectrin repeat 0.00000000000136
Family Spectrin repeat 0.0031
Further Details:      
 
Domain Number 21 Region: 392-528
Classification Level Classification E-value
Superfamily Spectrin repeat 0.00000000000196
Family Spectrin repeat 0.0019
Further Details:      
 
Domain Number 22 Region: 538-637
Classification Level Classification E-value
Superfamily Spectrin repeat 0.000000000667
Family Spectrin repeat 0.0017
Further Details:      
 
Domain Number 23 Region: 2052-2147
Classification Level Classification E-value
Superfamily Spectrin repeat 0.000000000907
Family Spectrin repeat 0.0023
Further Details:      
 
Domain Number 24 Region: 3422-3482
Classification Level Classification E-value
Superfamily Spectrin repeat 0.00000000576
Family Spectrin repeat 0.0024
Further Details:      
 
Domain Number 25 Region: 1842-1904
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0000935
Family Spectrin repeat 0.0065
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000317790   Gene: ENSG00000137877   Transcript: ENST00000320955
Sequence length 3674
Comment pep:known chromosome:GRCh37:15:42140345:42186275:-1 gene:ENSG00000137877 transcript:ENST00000320955 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAGQPHSPRELLGAAGHRSRRPSTELRVPPSPSLTMDSQYETGHIRKLQARHMQMQEKTF
TKWINNVFQCGQAGIKIRNLYTELADGIHLLRLLELISGEALPPPSRGRLRVHFLENSSR
ALAFLRAKVPVPLIGPENIVDGDQTLILGLIWVIILRFQISHISLDKEEFGASAALLSTK
EALLVWCQRKTASYTNVNITDFSRSWSDGLGFNALIHAHRPDLLDYGSLRPDRPLHNLAF
AFLVAEQELGIAQLLDPEDVAAAQPDERSIMTYVSLYYHYCSRLHQGQTVQRRLTKILLQ
LQETELLQTQYEQLVADLLRWIAEKQMQLEARDFPDSLPAMRQLLAAFTIFRTQEKPPRL
QQRGAAEALLFRLQTALQAQNRRPFLPHEGLGLAELSQCWAGLEWAEAARSQALQQRLLQ
LQRLETLARRFQHKAALRESFLKDAEQVLDQARAPPASLATVEAAVQRLGMLEAGILPQE
GRFQALAEIADILRQEQYHSWADVARRQEEVTVRWQRLLQHLQGQRKQVADMQAVLSLLQ
EVEAASHQLEELQEPARSTACGQQLAEVVELLQRHDLLEAQVSAHGAHVSHLAQQTAELD
SSLGTSVEVLQAKARTLAQLQQSLVALVRARRALLEQTLQRAEFLRNCEEEEAWLKECGQ
RVGNAALGRDLSQIAGALQKHKALEAEVHRHQAVCVDLVRRGRDLSARRPPTQPDPGERA
EAVQGGWQLLQTRVVGRGARLQTALLVLQYFADAAEAASWLRERRSSLERASCGQDQAAA
ETLLRRHVRLERVLRAFAAELRRLEEQGRAASARASLFTVNSALSPPGESLRNPGPWSEA
SCHPGPGDAWKMALPAEPDPDFDPNTILQTQDHLSQDYESLRALAQLRRARLEEAMALFG
FCSSCGELQLWLEKQTVLLQRVQPQADTLEVMQLKYENFLTALAVGKGLWAEVSSSAEQL
RQRYPGNSTQIQRQQEELSQRWGQLEALKREKAVQLAHSVEVCSFLQECGPTQVQLRDVL
LQLEALQPGSSEDTCHALQLAQKKTLVLERRVHFLQSVVVKVEEPGYAESQPLQGQVETL
QGLLKQVQEQVAQRARRQAETQARQSFLQESQQLLLWAESVQAQLRSKEVSVDVASAQRL
LREHQDLLEEIHLWQERLQQLDAQSQPMAALDCPDSQEVPNTLRVLGQQGQELKVLWEQR
QQWLQEGLELQKFGREVDGFTATCANHQAWLHLDNLGEDVREALSLLQQHREFGRLLSTL
GPRAEALRAHGEKLVQSQHPAAHTVREQLQSIQAQWTRLQGRSEQRRRQLLASLQLQEWK
QDVAELMQWMEEKGLMAAHEPSGARRNILQTLKRHEAAESELLATRRHVEALQQVGRELL
SRRPCGQEDIQTRLQGLRSKWEALNRKMTERGDELQQAGQQEQLLRQLQDAKEQLEQLEG
ALQSSETGQDLRSSQRLQKRHQQLESESRTLAAKMAALASMAHGMAASPAILEETQKHLR
RLELLQGHLAIRGLQLQASVELHQFCHLSNMELSWVAEHMPHGSPTSYTECLNGAQSLHR
KHKELQVEVKAHQGQVQRVLSSGRSLAASGHPQAQHIVEQCQELEGHWAELERACEARAQ
CLQQAVTFQQYFLDVSELEGWVEEKRPLVSSRDYGRDEAATLRLINKHQALQEELAIYWS
SMEELDQTAQTLTGPEVPEQQRVVQERLREQLRALQELAATRDRELEGTLRLHEFLREAE
DLQGWLASQKQAAKGGESLGEDPEHALHLCTKFAKFQHQVEMGSQRVAACRLLAESLLER
GHSAGPMVRQRQQDLQTAWSELWELTQARGHALRDTETTLRVHRDLLEVLTQVQEKATSL
PNNVARDLCGLEAQLRSHQGLERELVGTERQLQELLETAGRVQKLCPGPQAHAVQQRQQA
VTQAWAVLQRRMEQRRAQLERARLLARFRTAVRDYASWAARVRQDLQVEESSQEPSSGPL
KLSAHQWLRAELEAREKLWQQATQLGQQALLAAGTPTKEVQEELRALQDQRDQVYQTWAR
KQERLQAEQQEQLFLRECGRLEEILAAQEVSLKTSALGSSVEEVEQLIRKHEVFLKVLTA
QDKKEAALRERLKTLRRPRVRDRLPILLQRRMRVKELAESRGHALHASLLMASFTQAATQ
AEDWIQAWAQQLKEPVPPGDLRDKLKPLLKHQAFEAEVQAHEEVMTSVAKKGEALLAQSH
PRAGEVSQRLQGLRKHWEDLRQAMALRGQELEDRRNFLEFLQRVDLAEAWIQEKEVKMNV
GDLGQDLEHCLQLRRRLREFRGNSAGDTVGDACIRSISDLSLQLKNRDPEEVKIICQRRS
QLNNRWASFHGNLLRYQQQLEGALEIHVLSRELDNVTKRIQEKEALIQALDCGKDLESVQ
RLLRKHEELEREVHPIQAQVESLEREVGRLCQRSPEAAHGLRHRQQEVAESWWQLRSRAQ
KRREALDALHQAQKLQAMLQELLVSAQRLRAQMDTSPAPRSPVEARRMLEEHQECKAELD
SWTDSISLARSTGQQLLTAGHPFSSDIRQVLAGLEQELSSLEGAWQEHQLQLQQALELQL
FLSSVEKMERWLCSKEDSLASEGLWDPLAPMEPLLWKHKMLEWDLEVQAGKISALEATAR
GLHQGGHPEAQSALGRCQAMLLRKEALFRQAGTRRHRLEELRQLQAFLQDSQEVAAWLRE
KNLVALEEGLLDTAMLPAQLQKQQNFQAELDASMHQQQELQREGQRLLQGGHPASEAIQE
RLEELGALWGELQDNSQKKVAKLQKACEALRLRRSMEELENWLEPIEVELRAPTVGQALP
GVGELLGTQRELEAAVDKKARQAEALLGQAQAFVREGHCLAQDVEEQARRLLQRFKSLRE
PLQERRTALEARSLLLKFFRDADEEMAWVQEKLPLAAAQDYGQSLSAVRHLQEQHQNLES
EMSSHEALTRVVLGTGYKLVQAGHFAAHEVAARVQQLEKAMAHLRAEAARRRLLLQQAQE
AQQFLTELLEAGSWLAERGHVLDSEDMGHSAEATQALLRRLEATKRDLEAFSPRIERLQQ
TAALLESRKNPESPKVLAQLQAVREAHAELLRRAEARGHGLQEQLQLHQLERETLLLDAW
LTTKAATAESQDYGQDLEGVKVLEEKFDAFRKEVQSLGQAKVYALRKLAGTLERGAPRRY
PHIQAQRSRIEAAWERLDQAIKARTENLAAAHEVHSFQQAAAELQGRMQEKTALMKGEDG
GHSLSSVRTLQQQHRRLERELEAMEKEVARLQTEACRLGQLHPAAPGGLAKVQEAWATLQ
AKAQERGQWLAQAAQGHAFLGRCQELLAWAQERQELASSEELAEDVAGAEQLLGQHEELG
QEIRECRLQAQDLRQEGQQLVDNSHFMSAEVTECLQELEGRLQELEEAWALRWQRCAESW
GLQKLRQRLEQAEAWLACWEGLLLKPDYGHSVSDVELLLHRHQDLEKLLAAQEEKFAQMQ
KTEMEQELLLQPQELKPGRAGSSLTSFQWRPSGHQGLGAQLAETRDPQDAKGTPTMEGSL
EFKQHLLPGGRQPSSSSWDSCRGNLQGSSLSLFLDERMAAEKVASIALLDLTGARCERLR
GRHGRKHTFSLRLTSGAEILFAAPSEEQAESWWRALGSTAAQSLSPKLKAKPVSSLNECT
TKDARPGCLLRSDP
Download sequence
Identical sequences Q9NRC6
ENSP00000317790 ENSP00000317790 NP_057726.4.87134 NP_057726.4.92137 9606.ENSP00000317790 ENSP00000317790

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]