SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000319651 from Homo sapiens 69_37

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000319651
Domain Number 1 Region: 92-139
Classification Level Classification E-value
Superfamily Cysteine-rich DNA binding domain, (DM domain) 5.62e-17
Family Cysteine-rich DNA binding domain, (DM domain) 0.0003
Further Details:      
 
Domain Number 2 Region: 325-368
Classification Level Classification E-value
Superfamily UBA-like 0.00000074
Family CUE domain 0.077
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000319651   Gene: ENSG00000176399   Transcript: ENST00000325870
Sequence length 504
Comment pep:known chromosome:GRCh37:9:22446840:22452472:1 gene:ENSG00000176399 transcript:ENST00000325870 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MERSQCGSRDRGVSGRPHLAPGLVVAAPPPPSPALPVPSGMQVPPAFLRPPSLFLRAAAA
AAAAAAATSGSGGCPPAPGLESGVGAVGCGYPRTPKCARCRNHGVVSALKGHKRFCRWRD
CACAKCTLIAERQRVMAAQVALRRQQAQEESEARGLQRLLCSGLSWPPGGRASGGGGRAE
NPQSTGGPAAGAALGLGALRQASGSATPAFEVFQQDYPEEKQEQKESKCESCQNGQEELI
SKSHQLYLGSSSRSNGVIGKQSIGSSISEYSNKPDSILSPHPGEQSGGEESPRSLSSSDL
ESGNESEWVKDLTATKASLPTVSSRPRDPLDILTKIFPNYRRSRLEGILRFCKGDVVQAI
EQVLNGKEHKPDNRNLANSEELENTAFQRASSFSLAGIGFGTLGNKSAFSPLQTTSASYG
GDSSLYGVNPRVGISPLRLAYSSAGRGLSGFMSPYLTPGLVPTLPFRPALDYAFSGMIRD
SSYLSSKDSITCGRLYFRPNQDNP
Download sequence
Identical sequences Q5VZB9
ENSP00000319651 9606.ENSP00000319651 ENSP00000319651 ENSP00000319651 gi|170763515|ref|NP_071443.2| NP_071443.2.87134 NP_071443.2.92137

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]