SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000320493 from Homo sapiens 69_37

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000320493
Domain Number 1 Region: 10-287
Classification Level Classification E-value
Superfamily BAR/IMD domain-like 5.23e-77
Family FCH domain 0.0000000000946
Further Details:      
 
Domain Number 2 Region: 539-598
Classification Level Classification E-value
Superfamily SH3-domain 0.0000000000109
Family SH3-domain 0.0018
Further Details:      
 
Weak hits

Sequence:  ENSP00000320493
Domain Number - Region: 397-466
Classification Level Classification E-value
Superfamily DnaK suppressor protein DksA, alpha-hairpin domain 0.000183
Family DnaK suppressor protein DksA, alpha-hairpin domain 0.0059
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000320493   Gene: ENSG00000125733   Transcript: ENST00000313285
Sequence length 601
Comment pep:known chromosome:GRCh37:19:6739707:6751526:1 gene:ENSG00000125733 transcript:ENST00000313285 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDWGTELWDQFEVLERHTQWGLDLLDRYVKFVKERTEVEQAYAKQLRSLVKKYLPKRPAK
DDPESKFSQQQSFVQILQEVNDFAGQRELVAENLSVRVCLELTKYSQEMKQERKMHFQEG
RRAQQQLENGFKQLENSKRKFERDCREAEKAAQTAERLDQDINATKADVEKAKQQAHLRS
HMAEESKNEYAAQLQRFNRDQAHFYFSQMPQIFDKLQDMDERRATRLGAGYGLLSEAELE
VVPIIAKCLEGMKVAANAVDPKNDSHVLIELHKSGFARPGDVEFEDFSQPMNRAPSDSSL
GTPSDGRPELRGPGRSRTKRWPFGKKNKPRPPPLSPLGGPVPSALPNGPPSPRSGRDPLA
ILSEISKSVKPRLASFRSLRGSRGTVVTEDFSHLPPEQQRKRLQQQLEERSRELQKEVDQ
REALKKMKDVYEKTPQMGDPASLEPQIAETLSNIERLKLEVQKYEAWLAEAESRVLSNRG
DSLSRHARPPDPPASAPPDSSSNSASQDTKESSEEPPSEESQDTPIYTEFDEDFEEEPTS
PIGHCVAIYHFEGSSEGTISMAEGEDLSLMEEDKGDGWTRVRRKEGGEGYVPTSYLRVTL
N
Download sequence
Identical sequences Q15642
NP_001275891.1.87134 NP_001275891.1.92137 ENSP00000320117 ENSP00000320493 ENSP00000320117

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]