SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000321249 from Homo sapiens 69_37

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000321249
Domain Number 1 Region: 18-106
Classification Level Classification E-value
Superfamily Immunoglobulin 0.0000131
Family I set domains 0.036
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000321249   Gene: ENSG00000179213   Transcript: ENST00000316401
Sequence length 197
Comment pep:known chromosome:GRCh37:19:51760964:51772582:1 gene:ENSG00000179213 transcript:ENST00000316401 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLPLLQLVPAKLLNSSCSLEKTLQCSCSFHGIPTPSVQWWMGGVPVGVDGMDGSLQVTST
MLGPWANSTISLTEEPEMGMRLLCEGKNQNGTHALSILLMSRKSSLAAQAFVKGLIQGAI
YAGIVIALLFLCLLPLIVKHIRKKQAKKAAAIRAKKSSKVRASQELEMSLKPEEPGKPVV
ATFSESRILEKQDKRAS
Download sequence
Identical sequences Q8N7X8
9606.ENSP00000321249 NP_775906.1.87134 NP_775906.1.92137 XP_005258856.1.92137 XP_011525123.1.92137 gi|27735027|ref|NP_775906.1| ENSP00000321249 ENSP00000480286 ENSP00000321249 ENSP00000321249

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]