SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000322608 from Homo sapiens 69_37

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000322608
Domain Number 1 Region: 198-474
Classification Level Classification E-value
Superfamily BAR/IMD domain-like 1.22e-54
Family FCH domain 0.0034
Further Details:      
 
Domain Number 2 Region: 3-70
Classification Level Classification E-value
Superfamily SH3-domain 3.81e-18
Family SH3-domain 0.001
Further Details:      
 
Domain Number 3 Region: 73-109
Classification Level Classification E-value
Superfamily WW domain 0.0000000000386
Family WW domain 0.0015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000322608   Gene: ENSG00000007237   Transcript: ENST00000323816
Sequence length 476
Comment pep:known chromosome:GRCh37:17:9813926:10017870:-1 gene:ENSG00000007237 transcript:ENST00000323816 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSGARCRTLYPFSGERHGQGLRFAAGELITLLQVPDGGWWEGEKEDGLRGWFPASYVQLL
EKPGMVPPPPGEESQTVILPPGWQSYLSPQGRRYYVNTTTNETTWERPSSSPGIPASPGS
HRSSLPPTVNGYHASGTPAHPPETAHMSVRKSTGDSQNLGSSSPSKKQSKENTITINCVT
FPHPDTMPEQQLLKPTEWSYCDYFWADKKDPQGNGTVAGFELLLQKQLKGKQMQKEMSEF
IRERIKIEEDYAKNLAKLSQNSLASQEEGSLGEAWAQVKKSLADEAEVHLKFSAKLHSEV
EKPLMNFRENFKKDMKKCDHHIADLRKQLASRYASVEKARKALTERQRDLEMKTQQLEIK
LSNKTEEDIKKARRKSTQAGDDLMRCVDLYNQAQSKWFEEMVTTTLELERLEVERVEMIR
QHLCQYTQLRHETDMFNQSTVEPVDQLLRKVDPAKDRELWVREHKTGNIRPVDMEI
Download sequence
Identical sequences A0A2I3GSQ3 H2QC96 O60861
ENSNLEP00000012345 9598.ENSPTRP00000014931 9606.ENSP00000322608 gi|41406080|ref|NP_958839.1| ENSPTRP00000014931 ENSP00000322608 NP_958839.1.87134 NP_958839.1.92137 XP_003274725.1.23891 XP_003315707.2.37143 XP_003818142.1.60992 ENSP00000407552 ENSPTRP00000014931 ENSNLEP00000012345 ENSP00000407552

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]