SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000323148 from Homo sapiens 69_37

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000323148
Domain Number 1 Region: 49-140
Classification Level Classification E-value
Superfamily Retrovirus capsid dimerization domain-like 6.87e-39
Family SCAN domain 0.0000465
Further Details:      
 
Domain Number 2 Region: 441-498
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.28e-27
Family Classic zinc finger, C2H2 0.0031
Further Details:      
 
Domain Number 3 Region: 386-442
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.33e-25
Family Classic zinc finger, C2H2 0.0031
Further Details:      
 
Domain Number 4 Region: 483-535
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 7.5e-21
Family Classic zinc finger, C2H2 0.0041
Further Details:      
 
Domain Number 5 Region: 222-278
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 0.000000000693
Family KRAB domain (Kruppel-associated box) 0.011
Further Details:      
 
Domain Number 6 Region: 355-399
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000274
Family Classic zinc finger, C2H2 0.0088
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000323148   Gene: ENSG00000106261   Transcript: ENST00000324306
Sequence length 563
Comment pep:known chromosome:GRCh37:7:99613204:99639312:1 gene:ENSG00000106261 transcript:ENST00000324306 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MMTAESREATGLSPQAAQEKDGIVIVKVEEEDEEDHMWGQDSTLQDTPPPDPEIFRQRFR
RFCYQNTFGPREALSRLKELCHQWLRPEINTKEQILELLVLEQFLSILPKELQVWLQEYR
PDSGEEAVTLLEDLELDLSGQQVPGQVHGPEMLARGMVPLDPVQESSSFDLHHEATQSHF
KHSSRKPRLLQSRALPAAHIPAPPHEGSPRDQAMASALFTADSQAMVKIEDMAVSLILEE
WGCQNLARRNLSRDNRQENYGSAFPQGGENRNENEESTSKAETSEDSASRGETTGRSQKE
FGEKRDQEGKTGERQQKNPEEKTRKEKRDSGPAIGKDKKTITGERGPREKGKGLGRSFSL
SSNFTTPEEVPTGTKSHRCDECGKCFTRSSSLIRHKIIHTGEKPYECSECGKAFSLNSNL
VLHQRIHTGEKPHECNECGKAFSHSSNLILHQRIHSGEKPYECNECGKAFSQSSDLTKHQ
RIHTGEKPYECSECGKAFNRNSYLILHRRIHTREKPYKCTKCGKAFTRSSTLTLHHRIHA
RERASEYSPASLDAFGAFLKSCV
Download sequence
Identical sequences P17029
ENSP00000323148 NP_003430.1.87134 NP_003430.1.92137 XP_011514861.1.92137 gi|55769564|ref|NP_003430.1| 9606.ENSP00000323148 ENSP00000323148 ENSP00000323148

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]