SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000323927 from Homo sapiens 69_37

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSP00000323927
Domain Number - Region: 302-340
Classification Level Classification E-value
Superfamily Plexin repeat 0.000558
Family Plexin repeat 0.005
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000323927   Gene: ENSG00000161381   Transcript: ENST00000315392
Sequence length 500
Comment pep:known chromosome:GRCh37:17:37219556:37307902:-1 gene:ENSG00000161381 transcript:ENST00000315392 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MRGELWLLVLVLREAARALSPQPGAGHDEGPGSGWAAKGTVRGWNRRARESPGHVSEPDR
TQLSQDLGGGTLAMDTLPDNRTRVVEDNHSYYVSRLYGPSEPHSRELWVDVAEANRSQVK
IHTILSNTHRQASRVVLSFDFPFYGHPLRQITIATGGFIFMGDVIHRMLTATQYVAPLMA
NFNPGYSDNSTVVYFDNGTVFVVQWDHVYLQGWEDKGSFTFQAALHHDGRIVFAYKEIPM
SVPEISSSQHPVKTGLSDAFMILNPSPDVPESRRRSIFEYHRIELDPSKVTSMSAVEFTP
LPTCLQHRSCDACMSSDLTFNCSWCHVLQRCSSGFDRYRQEWMDYGCAQEAEGRMCEDFQ
DEDHDSASPDTSFSPYDGDLTTTSSSLFIDSLTTEDDTKLNPYAGGDGLQNNLSPKTKGT
PVHLGTIVGIVLAVLLVAAIILAGIYINGHPTSNAALFFIERRPHHWPAMKFRSHPDHST
YAEVEPSGHEKEGFMEAEQC
Download sequence
Identical sequences Q8IUK5
ENSP00000323927 9606.ENSP00000323927 NP_065138.2.87134 NP_065138.2.92137 ENSP00000323927 ENSP00000323927 NYSGXRC-13060a gi|15011862|ref|NP_065138.2|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]