SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000324287 from Homo sapiens 69_37

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000324287
Domain Number 1 Region: 4-289
Classification Level Classification E-value
Superfamily BAR/IMD domain-like 8.58e-81
Family BAR domain 0.00063
Further Details:      
 
Domain Number 2 Region: 400-515
Classification Level Classification E-value
Superfamily ArfGap/RecO-like zinc finger 3.27e-42
Family Pyk2-associated protein beta ARF-GAP domain 0.00016
Further Details:      
 
Domain Number 3 Region: 260-365
Classification Level Classification E-value
Superfamily PH domain-like 3.6e-28
Family Pleckstrin-homology domain (PH domain) 0.0036
Further Details:      
 
Domain Number 4 Region: 610-728
Classification Level Classification E-value
Superfamily Ankyrin repeat 3.07e-25
Family Ankyrin repeat 0.00064
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000324287   Gene: ENSG00000114331   Transcript: ENST00000326793
Sequence length 778
Comment pep:known chromosome:GRCh37:3:194995465:195163807:-1 gene:ENSG00000114331 transcript:ENST00000326793 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MKMTVDFEECLKDSPRFRAALEEVEGDVAELELKLDKLVKLCIAMIDTGKAFCVANKQFM
NGIRDLAQYSSNDAVVETSLTKFSDSLQEMINFHTILFDQTQRSIKAQLQNFVKEDLRKF
KDAKKQFEKVSEEKENALVKNAQVQRNKQHEVEEATNILTATRKCFRHIALDYVLQINVL
QSKRRSEILKSMLSFMYAHLAFFHQGYDLFSELGPYMKDLGAQLDRLVVDAAKEKREMEQ
KHSTIQQKDFSSDDSKLEYNVDAANGIVMEGYLFKRASNAFKTWNRRWFSIQNNQLVYQK
KFKDNPTVVVEDLRLCTVKHCEDIERRFCFEVVSPTKSCMLQADSEKLRQAWIKAVQTSI
ATAYREKGDESEKLDKKSSPSTGSLDSGNESKEKLLKGESALQRVQCIPGNASCCDCGLA
DPRWASINLGITLCIECSGIHRSLGVHFSKVRSLTLDTWEPELLKLMCELGNDVINRVYE
ANVEKMGIKKPQPGQRQEKEAYIRAKYVERKFVDKYSISLSPPEQQKKFVSKSSEEKRLS
ISKFGPGDQVRASAQSSVRSNDSGIQQSSDDGRESLPSTVSANSLYEPEGERQDSSMFLD
SKHLNPGLQLYRASYEKNLPKMAEALAHGADVNWANSEENKATPLIQAVLGGSLVTCEFL
LQNGANVNQRDVQGRGPLHHATVLGHTGQVCLFLKRGANQHATDEEGKDPLSIAVEAANA
DIVTLLRLARMNEEMRESEGLYGQPGDETYQDIFRDFSQMASNNPEKLNRFQQDSQKF
Download sequence
Identical sequences A0A2I3HHG2 H2QP05 Q15057
gi|187608516|ref|NP_036419.3| ENSP00000324287 NP_036419.3.87134 NP_036419.3.92137 XP_003280469.1.23891 XP_003807688.1.60992 XP_516962.3.37143 9598.ENSPTRP00000027113 9606.ENSP00000324287 ENSPTRP00000027113 ENSP00000324287 ENSPTRP00000027113 ENSNLEP00000010182 ENSNLEP00000010182 ENSP00000324287

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]