SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000325240 from Homo sapiens 69_37

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000325240
Domain Number 1 Region: 185-260
Classification Level Classification E-value
Superfamily SH3-domain 2.1e-20
Family SH3-domain 0.0000906
Further Details:      
 
Domain Number 2 Region: 2-30
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 0.0000000201
Family LASP-1 0.0028
Further Details:      
 
Weak hits

Sequence:  ENSP00000325240
Domain Number - Region: 32-59
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 0.000254
Family LIM domain 0.025
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000325240   Gene: ENSG00000002834   Transcript: ENST00000318008
Sequence length 261
Comment pep:known chromosome:GRCh37:17:37026112:37078023:1 gene:ENSG00000002834 transcript:ENST00000318008 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MNPNCARCGKIVYPTEKVNCLDKFWHKACFHCETCKMTLNMKNYKGYEKKPYCNAHYPKQ
SFTMVADTPENLRLKQQSELQSQVRYKEEFEKNKGKGFSVVADTPELQRIKKTQDQISNI
KYHEEFEKSRMGPSGGEGMEPERRDSQDGSSYRRPLEQQQPHHIPTSAPVYQQPQQQPVA
QSYGGYKEPAAPVSIQRSAPGGGGKRYRAVYDYSAADEDEVSFQDGDTIVNVQQIDDGWM
YGTVERTGDTGMLPANYVEAI
Download sequence
Identical sequences A0A024R1S8 H2R1V0 Q14847
NP_006139.1.87134 NP_006139.1.92137 XP_003809887.1.60992 XP_016786284.1.37143 ENSP00000325240 ENSP00000392853 9598.ENSPTRP00000042936 9606.ENSP00000325240 gi|5453710|ref|NP_006139.1| ENSP00000325240 ENSP00000325240 ENSP00000392853 ENSPTRP00000042936 NYSGXRC-9504a ENSPTRP00000042936

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]