SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000327608 from Homo sapiens 69_37

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000327608
Domain Number 1 Region: 355-480
Classification Level Classification E-value
Superfamily TIMP-like 2.83e-21
Family Tissue inhibitor of metalloproteinases, TIMP 0.021
Further Details:      
 
Domain Number 2 Region: 45-96
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.000000000549
Family TSP-1 type 1 repeat 0.001
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000327608   Gene: ENSG00000185761   Transcript: ENST00000330475
Sequence length 481
Comment pep:known chromosome:GRCh37:19:1505023:1513188:-1 gene:ENSG00000185761 transcript:ENST00000330475 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGKLRPGRVEWLASGHTERPHLFQNLLLFLWALLNCGLGVSAQGPGEWTPWVSWTRCSSS
CGRGVSVRSRRCLRLPGEEPCWGDSHEYRLCQLPDCPPGAVPFRDLQCALYNGRPVLGTQ
KTYQWVPFHGAPNQCDLNCLAEGHAFYHSFGRVLDGTACSPGAQGVCVAGRCLSAGCDGL
LGSGALEDRCGRCGGANDSCLFVQRVFRDAGAFAGYWNVTLIPEGARHIRVEHRSRNHLA
LMGGDGRYVLNGHWVVSPPGTYEAAGTHVVYTRDTGPQETLQAAGPTSHDLLLQVLLQEP
NPGIEFEFWLPRERYSPFQARVQALGWPLRQPQPRGVEPQPPAAPAVTPAQTPTLAPDPC
PPCPDTRGRAHRLLHYCGSDFVFQARVLGHHHQAQETRYEVRIQLVYKNRSPLRAREYVW
APGHCPCPMLAPHRDYLMAVQRLVSPDGTQDQLLLPHAGYARPWSPAEDSRIRLTARRCP
G
Download sequence
Identical sequences Q6ZMM2
ENSP00000327608 XP_005259606.1.92137 ENSP00000399364

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]