SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000328876 from Homo sapiens 69_37

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000328876
Domain Number 1 Region: 2-229
Classification Level Classification E-value
Superfamily BAR/IMD domain-like 1.26e-65
Family IMD domain 0.0000224
Further Details:      
 
Domain Number 2 Region: 326-410
Classification Level Classification E-value
Superfamily SH3-domain 0.0000000000126
Family SH3-domain 0.00042
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000328876   Gene: ENSG00000128298   Transcript: ENST00000332536
Sequence length 529
Comment pep:known chromosome:GRCh37:22:38489921:38506676:-1 gene:ENSG00000128298 transcript:ENST00000332536 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAPEMDQFYRSTMAIYKSIMEQFNPALENLVYLGNNYLRAFHALSEAAEVYFSAIQKIGE
RALQSPTSQILGEILVQMSDTQRHLNSDLEVVVQTFHGGLLQHMEKNTKLDMQFIKDSRQ
HYELEYRHRAANLEKCMSELWRMERKRDKNVREMKESVNRLHAQMQAFVSESQRAAELEE
KRRYRFLAEKHLLLSNTFLQFFGRARGMLQNRVLLWKEQSEASRSPSRAHSPGLLGPALG
PPYPSGRLTPTCLDMPPRPLGEFSSPRSRHGSGSYGTEPDARPASQLEPDRRSLPRTPSA
SSLYSGSAQSSRSNSFGERPGGGGGARRVRALVSHSEGANHTLLRFSAGDVVEVLVPEAQ
NGWLYGKLEGSSASGWFPEAYVKALEEGPVNPMTPVTPMTSMTSMSPMTPMNPGNELPSR
SYPLRGSHSLDDLLDRPGNSIAPSEYWDGQSRSRTPSRVPSRAPSPAPPPLPSSRRSSMG
STAVATDVKKLMSSEQYPPQELFPRGTNPFATVKLRPTITNDRSAPLIR
Download sequence
Identical sequences Q6UXY1
ENSP00000328876 ENSP00000371085 ENSP00000371085 9606.ENSP00000371085 NP_079321.3.87134 NP_079321.3.92137 XP_005261808.1.92137 gi|113205091|ref|NP_079321.3|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]