SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000329499 from Homo sapiens 69_37

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000329499
Domain Number 1 Region: 48-129
Classification Level Classification E-value
Superfamily Immunoglobulin 0.00000000713
Family V set domains (antibody variable domain-like) 0.049
Further Details:      
 
Domain Number 2 Region: 273-361
Classification Level Classification E-value
Superfamily Immunoglobulin 0.0000000815
Family I set domains 0.022
Further Details:      
 
Weak hits

Sequence:  ENSP00000329499
Domain Number - Region: 171-203
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.0275
Family TSP-1 type 1 repeat 0.0066
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000329499   Gene: ENSG00000214447   Transcript: ENST00000331733
Sequence length 413
Comment pep:known chromosome:GRCh37:17:42977142:42982758:1 gene:ENSG00000214447 transcript:ENST00000331733 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MHLALTTVLLWAWGLQAFEIVEKENIFQRTPCPAFLMFENAAYLADMSFELPCHCKPEEV
PAVVWFYQKHLGSSHTKVLTDFDGRVLTEAAQVRVGSDMLTRFSIRMFSLLVFRAQSEDS
GLYFCGTRKGDYFYAYDVDIQNSEGMVATFQDKGQEPFADEYYGHLHVFTTFWEWTPCDR
CGVRGEQWRIGLCYLQSPDLSPRYLKAVPDVVSCGSRAVPRKLRTKARDHTPEVLVRSCL
VPCEKTKTIREGVLAIINYVSKVGSRPWVPQVPIQFHQQRLGHGLIISCPGARPEHAVAW
DKDRQHLYRTQYLKGVNRSMRVFIDHGNQLHIRFTQLDDRGIYYCWRQGVLVAGFRLGVT
SHGHYPASFSDPETRSAVELTLIGYLLITAVFVTIHFCRCCCYLFHCCPSFSP
Download sequence
Identical sequences A6NFU0
ENSP00000329499 ENSP00000391869 ENSP00000329499 9606.ENSP00000329499 ENSP00000329499 NYSGRC-IgSF-YQ028_HUMAN

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]