SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000330278 from Homo sapiens 69_37

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000330278
Domain Number 1 Region: 469-533,575-673
Classification Level Classification E-value
Superfamily PH domain-like 2.13e-32
Family Pleckstrin-homology domain (PH domain) 0.0044
Further Details:      
 
Domain Number 2 Region: 679-806
Classification Level Classification E-value
Superfamily PH domain-like 5.39e-20
Family Pleckstrin-homology domain (PH domain) 0.0089
Further Details:      
 
Domain Number 3 Region: 1093-1225
Classification Level Classification E-value
Superfamily Second domain of FERM 1.23e-18
Family Second domain of FERM 0.0056
Further Details:      
 
Weak hits

Sequence:  ENSP00000330278
Domain Number - Region: 994-1071
Classification Level Classification E-value
Superfamily Ubiquitin-like 0.000331
Family Ubiquitin-related 0.047
Further Details:      
 
Domain Number - Region: 37-128,580-600
Classification Level Classification E-value
Superfamily BAR/IMD domain-like 0.000628
Family BAR domain 0.05
Further Details:      
 
Domain Number - Region: 1229-1287
Classification Level Classification E-value
Superfamily PH domain-like 0.00959
Family Third domain of FERM 0.065
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000330278   Gene: ENSG00000054690   Transcript: ENST00000329153
Sequence length 1364
Comment pep:known chromosome:GRCh37:14:68000018:68056329:1 gene:ENSG00000054690 transcript:ENST00000329153 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAELKVEAPASVDWQKRCLTLETQLFRFRLQASKIRELLADKMQELEQRLLEAEQRAENA
ETQVGVMEEKVKLSNLKNVDSEGSLHRKYQELLKAIKGKDELISQLEAQLEKQKQMRAEE
AKTVQEKAAKIKEWVTLKLAKLEMENQHLKSHNQRLVEQVGSLQDALEAIQIAPSRKLLV
PPYGAAEQDSVPSEPGIQPMGQDSGSQAQGLKAAVLAPSPGALQSKDSVSEAASPLEDSS
SSTVHSGETVEAKPLQPHLGRESPPHQPCMKLLTFRCSSASWGEGLVTAQRGMLPGTKTS
AREGGPGSSLTLPKVRAPGTPRDSIQLAKRHHSQPQVGHGHFGRVVNIETEAFSALHPSG
LPELESRARSREEPEKMEMEEPPPAGKNEERESPKALGAELEEVELGNKPPTPPLHQFSS
WESRIYAVATSGMRLSDMSPRSNTACCASSPPALVSPGSFSGLVYKNVTVPVYTALKGRA
TQISNMPFMDESSGSDDDCSSQASFRISVPSSESRKTSGLGSPRAIKRGVSMSSLSSEGD
YAIPPDACSLDSDYSEPEHKLQRTSSYSTDGLGLGGESLEKSGYLLKMGSQVKTWKRRWF
VLRQGQIMYYKSPSDVIRKPQGQVDLNSRCQIVRGEGSQTFQLISEKKTYYLTADSPSLL
EEWIRVLQSLLKVQATGPPALLRGGTKPTVKGWLTKVKHGHSKVVWCALVGKIFYYYRSH
EDKRPLGCLPVRDAHIEEVDRSCDSDEDYEAGGTRRLLSSHCTLVIHPTEHSPTYLLIGT
KHEKDTWLYHLTVAAGGSSAKVGTAYEQLIGKLMDGEGDPDSPLWRHPMLCYSKDGLYAS
LTTLPSEALQTEALKLFKSCQLFINVPVEAASVDYHVSLAQTALQVCLVHPELQSEIYCQ
LMKQTSCRPPQKYSLMQCWQLLALCAPLFLPQHHFLWYVKQQLQRHADPRSETGQYATYC
QRAVERTLRTGEREARPSRMEVVSILLRNPFHHSLPFSIPVHFTNGTYHVVGFDGSSTVD
EFLQRLNQEIGMRKPSHSGFALFTDDPSGRDLEHCLQGSVKICDAISKWEQAMKELHPGK
SEGGTRVVKLMYKNRLYFRSQVKGETDRERLLLASQTSREIVAGRFPINKELALEMAALM
AQVEYGDLEKPALPGPGGTSPAKAQHLLQQVLDRFHPRRYRHGAPAEQLRHLADMLTTKW
ATLQGCSPPECIRIYLTVARKWPFFGAKLFAAQPAQLSSKENALVWIAVNEDGVSILDHN
TMQVHITYPYSSVTTFGGCRDDFMLVIRSIPDKSSGKSHIEKLIFRMAAPKIAEATFIMA
SYMNHCTTTVNPPTNPPGACQLWELDGRQFFSSVSCATKGPTLL
Download sequence
Identical sequences Q9ULM0
gi|55741447|ref|NP_065766.1| NP_065766.1.87134 NP_065766.1.92137 ENSP00000330278 ENSP00000330278 9606.ENSP00000330278 ENSP00000330278

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]