SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000331857 from Homo sapiens 69_37

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000331857
Domain Number 1 Region: 543-972
Classification Level Classification E-value
Superfamily RNI-like 2.71e-86
Family 28-residue LRR 0.0000146
Further Details:      
 
Domain Number 2 Region: 4-94
Classification Level Classification E-value
Superfamily DEATH domain 3.88e-28
Family Pyrin domain, PYD 0.0062
Further Details:      
 
Domain Number 3 Region: 119-314
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 0.000000182
Family Nucleotide and nucleoside kinases 0.046
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000331857   Gene: ENSG00000185792   Transcript: ENST00000332836
Sequence length 991
Comment pep:known chromosome:GRCh37:19:56219798:56249768:-1 gene:ENSG00000185792 transcript:ENST00000332836 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAESFFSDFGLLWYLKELRKEEFWKFKELLKQPLEKFELKPIPWAELKKASKEDVAKLLD
KHYPGKQAWEVTLNLFLQINRKDLWTKAQEEMRNKLNPYRKHMKETFQLIWEKETCLHVP
EHFYKETMKNEYKELNDAYTAAARRHTVVLEGPDGIGKTTLLRKVMLDWAEGNLWKDRFT
FVFFLNVCEMNGIAETSLLELLSRDWPESSEKIEDIFSQPERILFIMDGFEQLKFNLQLK
ADLSDDWRQRQPMPIILSSLLQKKMLPESSLLIALGKLAMQKHYFMLRHPKLIKLLGFSE
SEKKSYFSYFFGEKSKALKVFNFVRDNGPLFILCHNPFTCWLVCTCVKQRLERGEDLEIN
SQNTTYLYASFLTTVFKAGSQSFPPKVNRARLKSLCALAAEGIWTYTFVFSHGDLRRNGL
SESEGVMWVGMRLLQRRGDCFAFMHLCIQEFCAAMFYLLKRPKDDPNPAIGSITQLVRAS
VVQPQTLLTQVGIFMFGISTEEIVSMLETSFGFPLSKDLKQEITQCLESLSQCEADREAI
AFQELFIGLFETQEKEFVTKVMNFFEEVFIYIGNIEHLVIASFCLKHCQHLTTLRMCVEN
IFPDDSGCISDYNEKLVYWRELCSMFITNKNFQILDMENTSLDDPSLAILCKALAQPVCK
LRKLIFTSVYFGHDSELFKAVLHNPHLKLLSLYGTSLSQSDIRHLCETLKHPMCKIEELI
LGKCDISSEVCEDIASVLACNSKLKHLSLVENPLRDEGMTLLCEALKHSHCALERLMLMY
CCLTSVSCDSISEVLLCSKSLSLLDLGSNALEDNGVASLCAALKHPGCSIRELWLMGCFL
TSDSCKDIAAVLICNGKLKTLKLGHNEIGDTGVRQLCAALQHPHCKLECLGLQTCPITRA
CCDDIAAALIACKTLRSLNLDWIALDADAVVVLCEALSHPDCALQMLGLHKSGFDEETQK
ILMSVEEKIPHLTISHGPWIDEEYKIRGVLL
Download sequence
Identical sequences Q7RTR0
gi|33519450|ref|NP_789790.2| ENSP00000331857 9606.ENSP00000331857 ENSP00000331857 ENSP00000331857 NP_789790.2.87134 NP_789790.2.92137

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]