SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000332511 from Homo sapiens 69_37

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSP00000332511
Domain Number - Region: 30-104
Classification Level Classification E-value
Superfamily BAR/IMD domain-like 0.0216
Family BAR domain 0.08
Further Details:      
 
Domain Number - Region: 208-309,351-392
Classification Level Classification E-value
Superfamily 3-carboxy-cis,cis-mucoante lactonizing enzyme 0.0745
Family 3-carboxy-cis,cis-mucoante lactonizing enzyme 0.043
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000332511   Gene: ENSG00000183801   Transcript: ENST00000329293
Sequence length 402
Comment pep:known chromosome:GRCh37:11:7506713:7532608:1 gene:ENSG00000183801 transcript:ENST00000329293 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MMVALRGASALLVLFLAAFLPPPQCTQDPAMVHYIYQRFRVLEQGLEKCTQATRAYIQEF
QEFSKNISVMLGRCQTYTSEYKSAVGNLALRVERAQREIDYIQYLREADECIESEDKTLA
EMLLQEAEEEKKIRTLLNASCDNMLMGIKSLKIVKKMMDTHGSWMKDAVYNSPKVYLLIG
SRNNTVWEFANIRAFMEDNTKPAPRKQILTLSWQGTGQVIYKGFLFFHNQATSNEIIKYN
LQKRTVEDRMLLPGGVGRALVYQHSPSTYIDLAVDEHGLWAIHSGPGTHSHLVLTKIEPG
TLGVEHSWDTPCRSQDAEASFLLCGVLYVVYSTGGQGPHRITCIYDPLGTISEEDLPNLF
FPKRPRSHSMIHYNPRDKQLYAWNEGNQIIYKLQTKRKLPLK
Download sequence
Identical sequences Q6UWY5
9606.ENSP00000332511 ENSP00000332511 ENSP00000332511 ENSP00000433455 gi|284172520|ref|NP_940876.2| NP_940876.2.87134 NP_940876.2.92137 XP_005252935.1.92137 ENSP00000332511 ENSP00000433455

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]