SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000334156 from Homo sapiens 69_37

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000334156
Domain Number 1 Region: 14-279
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 8.35e-92
Family Calponin-homology domain, CH-domain 0.000000733
Further Details:      
 
Domain Number 2 Region: 2191-2310
Classification Level Classification E-value
Superfamily PH domain-like 4.37e-38
Family Pleckstrin-homology domain (PH domain) 0.00000201
Further Details:      
 
Domain Number 3 Region: 295-416
Classification Level Classification E-value
Superfamily Spectrin repeat 7.72e-36
Family Spectrin repeat 0.0000528
Further Details:      
 
Domain Number 4 Region: 1011-1165
Classification Level Classification E-value
Superfamily Spectrin repeat 3.6e-29
Family Spectrin repeat 0.0000216
Further Details:      
 
Domain Number 5 Region: 603-729
Classification Level Classification E-value
Superfamily Spectrin repeat 1.44e-28
Family Spectrin repeat 0.0004
Further Details:      
 
Domain Number 6 Region: 1223-1376
Classification Level Classification E-value
Superfamily Spectrin repeat 6.86e-28
Family Spectrin repeat 0.00046
Further Details:      
 
Domain Number 7 Region: 1859-2013
Classification Level Classification E-value
Superfamily Spectrin repeat 2.26e-27
Family Spectrin repeat 0.0021
Further Details:      
 
Domain Number 8 Region: 812-951
Classification Level Classification E-value
Superfamily Spectrin repeat 3.53e-26
Family Spectrin repeat 0.0017
Further Details:      
 
Domain Number 9 Region: 1453-1590
Classification Level Classification E-value
Superfamily Spectrin repeat 1.2e-24
Family Spectrin repeat 0.00035
Further Details:      
 
Domain Number 10 Region: 694-814
Classification Level Classification E-value
Superfamily Spectrin repeat 3.4e-24
Family Spectrin repeat 0.0014
Further Details:      
 
Domain Number 11 Region: 425-528
Classification Level Classification E-value
Superfamily Spectrin repeat 1.7e-23
Family Spectrin repeat 0.00032
Further Details:      
 
Domain Number 12 Region: 1699-1804
Classification Level Classification E-value
Superfamily Spectrin repeat 8.51e-23
Family Spectrin repeat 0.0031
Further Details:      
 
Domain Number 13 Region: 1595-1696
Classification Level Classification E-value
Superfamily Spectrin repeat 2.75e-22
Family Spectrin repeat 0.00095
Further Details:      
 
Domain Number 14 Region: 529-637
Classification Level Classification E-value
Superfamily Spectrin repeat 7.85e-22
Family Spectrin repeat 0.0004
Further Details:      
 
Domain Number 15 Region: 1384-1482
Classification Level Classification E-value
Superfamily Spectrin repeat 9.95e-18
Family Spectrin repeat 0.00043
Further Details:      
 
Domain Number 16 Region: 1986-2079
Classification Level Classification E-value
Superfamily Spectrin repeat 0.00000000000000995
Family Spectrin repeat 0.0017
Further Details:      
 
Weak hits

Sequence:  ENSP00000334156
Domain Number - Region: 1169-1242
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0122
Family Spectrin repeat 0.00024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000334156   Gene: ENSG00000115306   Transcript: ENST00000333896
Sequence length 2364
Comment pep:known chromosome:GRCh37:2:54785531:54889445:1 gene:ENSG00000115306 transcript:ENST00000333896 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTTTVATDYDNIEIQQQYSDVNNRWDVDDWDNENSSARLFERSRIKALADEREAVQKKTF
TKWVNSHLARVSCRITDLYTDLRDGRMLIKLLEVLSGERLPKPTKGRMRIHCLENVDKAL
QFLKEQRVHLENMGSHDIVDGNHRLTLGLIWTIILRFQIQDISVETEDNKEKKSAKDALL
LWCQMKTAGYPNVNIHNFTTSWRDGMAFNALIHKHRPDLIDFDKLKKSNAHYNLQNAFNL
AEQHLGLTKLLDPEDISVDHPDEKSIITYVVTYYHYFSKMKALAVEGKRIGKVLDNAIET
EKMIEKYESLASDLLEWIEQTIIILNNRKFANSLVGVQQQLQAFNTYRTVEKPPKFTEKG
NLEVLLFTIQSKMRANNQKVYMPREGKLISDINKAWERLEKAEHERELALRNELIRQEKL
EQLARRFDRKAAMRETWLSENQRLVSQDNFGFDLPAVEAATKKHEAIETDIAAYEERVQA
VVAVARELEAENYHDIKRITARKDNVIRLWEYLLELLRARRQRLEMNLGLQKIFQEMLYI
MDWMDEMKVLVLSQDYGKHLLGVEDLLQKHTLVEADIGIQAERVRGVNASAQKFATDGEG
YKPCDPQVIRDRVAHMEFCYQELCQLAAERRARLEESRRLWKFFWEMAEEEGWIREKEKI
LSSDDYGKDLTSVMRLLSKHRAFEDEMSGRSGHFEQAIKEGEDMIAEEHFGSEKIRERII
YIREQWANLEQLSAIRKKRLEEASLLHQFQADADDIDAWMLDILKIVSSSDVGHDEYSTQ
SLVKKHKDVAEEIANYRPTLDTLHEQASALPQEHAESPDVRGRLSGIEERYKEVAELTRL
RKQALQDTLALYKMFSEADACELWIDEKEQWLNNMQIPEKLEDLEVIQHRFESLEPEMNN
QASRVAVVNQIARQLMHSGHPSEKEIKAQQDKLNTRWSQFRELVDRKKDALLSALSIQNY
HLECNETKSWIREKTKVIESTQDLGNDLAGVMALQRKLTGMERDLVAIEAKLSDLQKEAE
KLESEHPDQAQAILSRLAEISDVWEEMKTTLKNREASLGEASKLQQFLRDLDDFQSWLSR
TQTAIASEDMPNTLTEAEKLLTQHENIKNEIDNYEEDYQKMRDMGEMVTQGQTDAQYMFL
RQRLQALDTGWNELHKMWENRQNLLSQSHAYQQFLRDTKQAEAFLNNQEYVLAHTEMPTT
LEGAEAAIKKQEDFMTTMDANEEKINAVVETGRRLVSDGNINSDRIQEKVDSIDDRHRKN
RETASELLMRLKDNRDLQKFLQDCQELSLWINEKMLTAQDMSYDEARNLHSKWLKHQAFM
AELASNKEWLDKIEKEGMQLISEKPETEAVVKEKLTGLHKMWEVLESTTQTKAQRLFDAN
KAELFTQSCADLDKWLHGLESQIQSDDYGKDLTSVNILLKKQQMLENQMEVRKKEIEELQ
SQAQALSQEGKSTDEVDSKRLTVQTKFMELLEPLNERKHNLLASKEIHQFNRDVEDEILW
VGERMPLATSTDHGHNLQTVQLLIKKNQTLQKEIQGHQPRIDDIFERSQNIVTDSSSLSA
EAIRQRLADLKQLWGLLIEETEKRHRRLEEAHRAQQYYFDAAEAEAWMSEQELYMMSEEK
AKDEQSAVSMLKKHQILEQAVEDYAETVHQLSKTSRALVADSHPESERISMRQSKVDKLY
AGLKDLAEERRGKLDERHRLFQLNREVDDLEQWIAEREVVAGSHELGQDYEHVTMLQERF
REFARDTGNIGQERVDTVNHLADELINSGHSDAATIAEWKDGLNEAWADLLELIDTRTQI
LAASYELHKFYHDAKEIFGRIQDKHKKLPEELGRDQNTVETLQRMHTTFEHDIQALGTQV
RQLQEDAARLQAAYAGDKADDIQKRENEVLEAWKSLLDACESRRVRLVDTGDKFRFFSMV
RDLMLWMEDVIRQIEAQEKPRDVSSVELLMNNHQGIKAEIDARNDSFTTCIELGKSLLAR
KHYASEEIKEKLLQLTEKRKEMIDKWEDRWEWLRLILEVHQFSRDASVAEAWLLGQEPYL
SSREIGQSVDEVEKLIKRHEAFEKSAATWDERFSALERLTTLELLEVRRQQEEEERKRRP
PSPEPSTKVSEEAESQQQWDTSKGEQVSQNGLPAEQGSPRMAETVDTSEMVNGATEQRTS
SKESSPIPSPTSDRKAKTALPAQSAATLPARTQETPSAQMEGFLNRKHEWEAHNKKASSR
SWHNVYCVINNQEMGFYKDAKTAASGIPYHSEVPVSLKEAVCEVALDYKKKKHVFKLRLN
DGNEYLFQAKDDEEMNTWIQAISSAISSDKHEVSASTQSTPASSRAQTLPTSVVTITSES
SPGKREKDKEKDKEKRFSLFGKKK
Download sequence
Identical sequences B2ZZ89 H2R3X5 Q01082
NP_003119.2.87134 NP_003119.2.92137 XP_001154155.1.37143 XP_003830884.1.60992 XP_005264574.1.92137 XP_006712150.1.92137 XP_009440743.1.37143 XP_016860268.1.92137 XP_016860269.1.92137 XP_016860270.1.92137 gi|112382250|ref|NP_003119.2| ENSPTRP00000046250 ENSP00000349259 ENSP00000349259 ENSPTRP00000046250 9606.ENSP00000349259 ENSP00000334156

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]