SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000335029 from Homo sapiens 69_37

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000335029
Domain Number 1 Region: 297-619
Classification Level Classification E-value
Superfamily GTPase activation domain, GAP 3.34e-90
Family p120GAP domain-like 0.0000706
Further Details:      
 
Domain Number 2 Region: 577-713
Classification Level Classification E-value
Superfamily PH domain-like 3.67e-48
Family Pleckstrin-homology domain (PH domain) 0.0024
Further Details:      
 
Domain Number 3 Region: 146-307
Classification Level Classification E-value
Superfamily C2 domain (Calcium/lipid-binding domain, CaLB) 1.87e-26
Family Synaptotagmin-like (S variant) 0.039
Further Details:      
 
Domain Number 4 Region: 14-133
Classification Level Classification E-value
Superfamily C2 domain (Calcium/lipid-binding domain, CaLB) 2.81e-24
Family Synaptotagmin-like (S variant) 0.062
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000335029   Gene: ENSG00000185989   Transcript: ENST00000334062
Sequence length 834
Comment pep:known chromosome:GRCh37:13:114747194:114898086:-1 gene:ENSG00000185989 transcript:ENST00000334062 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAVEDEGLRVFQSVKIKIGEAKNLPSYPGPSKMRDCYCTVNLDQEEVFRTKIVEKSLCPF
YGEDFYCEIPRSFRHLSFYIFDRDVFRRDSIIGKVAIQKEDLQKYHNRDTWFQLQHVDAD
SEVQGKVHLELRLSEVITDTGVVCHKLATRIVECQGLPIVNGQCDPYATVTLAGPFRSEA
KKTKVKRKTNNPQFDEVFYFEVTRPCSYSKKSHFDFEEEDVDKLEIRVDLWNASNLKFGD
EFLGELRIPLKVLRQSSSYEAWYFLQPRDNGSKSLKPDDLGSLRLNVVYTEDHVFSSDYY
SPLRDLLLKSADVEPVSASAAHILGEVCREKQEAAVPLVRLFLHYGRVVPFISAIASAEV
KRTQDPNTIFRGNSLASKCIDETMKLAGMHYLHVTLKPAIEEICQSHKPCEIDPVKLKDG
ENLENNMENLRQYVDRVFHAITESGVSCPTVMCDIFFSLREAAAKRFQDDPDVRYTAVSS
FIFLRFFAPAILSPNLFQLTPHHTDPQTSRTLTLISKTVQTLGSLSKSKSASFKESYMAT
FYEFFNEQKYADAVKNFLDLISSSGRRDPKSVEQPIVLKEGFMIKRAQGRKRFGMKNFKK
RWFRLTNHEFTYHKSKGDQPLYSIPIENILAVEKLEEESFKMKNMFQVIQPERALYIQAN
NCVEAKDWIDILTKVSQCNQKRLTVYHPSAYLSGHWLCCRAPSDSAPGCSPCTGGLPANI
QLDIDGDRETERIYSLFNLYMSKLEKMQEACGSKSVYDGPEQEEYSTFVIDDPQETYKTL
KQVIAGVGALEQEHAQYKRDKFKKTKYGSQEHPIGDKSFQNYIRQQSETSTHSI
Download sequence
Identical sequences Q14644
ENSP00000335029 HR3326 hsg002001512.1 ENSP00000335029 9606.ENSP00000335029 gi|38201692|ref|NP_031394.2| NP_031394.2.87134 NP_031394.2.92137 ENSP00000335029

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]