SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000336565 from Homo sapiens 69_37

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000336565
Domain Number 1 Region: 22-109
Classification Level Classification E-value
Superfamily Retrovirus capsid dimerization domain-like 3.16e-37
Family SCAN domain 0.0000141
Further Details:      
 
Domain Number 2 Region: 390-441
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000000000235
Family Classic zinc finger, C2H2 0.0066
Further Details:      
 
Domain Number 3 Region: 209-251
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 0.00000000000471
Family KRAB domain (Kruppel-associated box) 0.0026
Further Details:      
 
Domain Number 4 Region: 326-356
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000168
Family Classic zinc finger, C2H2 0.0096
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000336565   Gene: ENSG00000083838   Transcript: ENST00000335841
Sequence length 450
Comment pep:known chromosome:GRCh37:19:58987795:58992591:1 gene:ENSG00000083838 transcript:ENST00000335841 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPSPLGPPCLPVMDPETTLEEPETARLRFRGFCYQEVAGPREALARLRELCCQWLQPEAH
SKEQMLEMLVLEQFLGTLPPEIQAWVRGQRPGSPEEAAALVEGLQHDPGQLLGWITAHVL
KQEVLPAAQKTEEPLGSPHPSGTVESPGEGPQDTRIEGSVQLSCSVKEEPNVDGQEVAPS
SPPLAAQSPEGNHGHQEPASTSFHPPRIQEEWGLLDRSQKELYWDAMLEKYGTVVSLGLP
PHQPEAQAQSELGMLLTGTGVCRSLRSGNESEGPPGCPEAQPPQGPGPAAWEGLSGAATP
APTVRPGTPPVPTQPTPAETRLEPAATPRKPYTCEQCGRGFDWKSVFVIHHRTHTSGPGV
QSPGLATGESTEKPPQGEVAFPHHPRRSLTGPRSYPCEECGCSFSWKSQLVIHRKSHTGQ
RRHFCSDCGRAFDWKSQLVIHRKGHRPEVP
Download sequence
Identical sequences Q9NWS9
9606.ENSP00000336565 gi|8923582|ref|NP_060378.1| ENSP00000472802 NP_060378.1.87134 NP_060378.1.92137 XP_005259109.1.92137 ENSP00000336565 ENSP00000472802

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]