SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000337363 from Homo sapiens 69_37

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000337363
Domain Number 1 Region: 57-148
Classification Level Classification E-value
Superfamily Retrovirus capsid dimerization domain-like 2.29e-37
Family SCAN domain 0.0000426
Further Details:      
 
Domain Number 2 Region: 452-506
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.12e-21
Family Classic zinc finger, C2H2 0.006
Further Details:      
 
Domain Number 3 Region: 356-408
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.37e-20
Family Classic zinc finger, C2H2 0.0036
Further Details:      
 
Domain Number 4 Region: 491-543
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 3.42e-20
Family Classic zinc finger, C2H2 0.0036
Further Details:      
 
Domain Number 5 Region: 394-449
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 5.12e-19
Family Classic zinc finger, C2H2 0.018
Further Details:      
 
Domain Number 6 Region: 149-196
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 0.0000000000157
Family KRAB domain (Kruppel-associated box) 0.0061
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000337363   Gene: ENSG00000160908   Transcript: ENST00000337673
Sequence length 561
Comment pep:known chromosome:GRCh37:7:99090863:99097920:-1 gene:ENSG00000160908 transcript:ENST00000337673 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MNSSLTAQRRGSDAELGPWVMAARSKDAAPSQRDGLLPVKVEEDSPGSWEPNYPAASPDP
ETSRLHFRQLRYQEVAGPEEALSRLRELCRRWLRPELLSKEQILELLVLEQFLTILPEEL
QAWVREHCPESGEEAVAVVRALQRALDGTSSQGMVTFEDTAVSLTWEEWERLDPARRDFC
RESAQKDSGSTVPPSLESRVENKELIPMQQILEEAEPQGQLQEAFQGKRPLFSKCGSTHE
DRVEKQSGDPLPLKLENSPEAEGLNSISDVNKNGSIEGEDSKNNELQNSARCSNLVLCQH
IPKAERPTDSEEHGNKCKQSFHMVTWHVLKPHKSDSGDSFHHSSLFETQRQLHEERPYKC
GNCGKSFKQRSDLFRHQRIHTGEKPYGCQECGKSFSQSAALTKHQRTHTGEKPYTCLKCG
ERFRQNSHLNRHQSTHSRDKHFKCEECGETCHISNLFRHQRLHKGERPYKCEECEKSFKQ
RSDLFKHHRIHTGEKPYGCSVCGKRFNQSATLIKHQRIHTGEKPYKCLECGERFRQSTHL
IRHQRIHQNKVLSAGRGGSRL
Download sequence
Identical sequences Q53GI3
NP_115540.2.87134 NP_115540.2.92137 ENSP00000337363 ENSP00000337363 gi|31982909|ref|NP_115540.2| 9606.ENSP00000337363 ENSP00000337363

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]