SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000338379 from Homo sapiens 69_37

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000338379
Domain Number 1 Region: 23-304
Classification Level Classification E-value
Superfamily BAR/IMD domain-like 7.14e-71
Family FCH domain 0.0042
Further Details:      
 
Domain Number 2 Region: 430-483
Classification Level Classification E-value
Superfamily SH3-domain 7.1e-21
Family SCOPe 0.0018
Further Details:      
 
Domain Number 3 Region: 348-355,423-483
Classification Level Classification E-value
Superfamily CATH 7.38e-17
Family CATH 0.0059
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000338379   Gene: ENSG00000100266   Transcript: ENST00000337959
Sequence length 486
Comment pep:known chromosome:GRCh37:22:43265777:43411151:-1 gene:ENSG00000100266 transcript:ENST00000337959 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSVTYDDSVGVEVSSDSFWEVGNYKRTVKRIDDGHRLCSDLMNCLHERARIEKAYAQQLT
EWARRWRQLVEKGPQYGTVEKAWMAFMSEAERVSELHLEVKASLMNDDFEKIKNWQKEAF
HKQMMGGFKETKEAEDGFRKAQKPWAKKLKEVEAAKKAHHAACKEEKLAISREANSKADP
SLNPEQLKKLQDKIEKCKQDVLKTKEKYEKSLKELDQGTPQYMENMEQVFEQCQQFEEKR
LRFFREVLLEVQKHLDLSNVAGYKAIYHDLEQSIRAADAVEDLRWFRANHGPGMAMNWPQ
FEEWSADLNRTLSRREKKKATDGVTLTGINQTGDQSLPSKPSSTLNVPSNPAQSAQSQSS
YNPFEDEDDTGSTVSEKDDTKAKNVSSYEKTQSYPTDWSDDESNNPFSSTDANGDSNPFD
DDATSGTEVRVRALYDYEGQEHDELSFKAGDELTKMEDEDEQGWCKGRLDNGQVGLYPAN
YVEAIQ
Download sequence
Identical sequences Q9UNF0
ENSP00000338379 NP_001171899.1.87134 NP_001171899.1.92137 NP_009160.2.87134 NP_009160.2.92137 XP_016884053.1.92137 hsi002005889.1 hsi002005889.2 3haj_A 3haj_B gi|148747351|ref|NP_009160.2| gi|296841091|ref|NP_001171899.1| ENSP00000263246 ENSP00000385040 ENSP00000385372 9606.ENSP00000263246 ENSP00000263246 ENSP00000385040 ENSP00000385372

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]