SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000341489 from Homo sapiens 69_37

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000341489
Domain Number 1 Region: 392-601
Classification Level Classification E-value
Superfamily GTPase activation domain, GAP 1.22e-46
Family BCR-homology GTPase activation domain (BH-domain) 0.0000817
Further Details:      
 
Weak hits

Sequence:  ENSP00000341489
Domain Number - Region: 263-382
Classification Level Classification E-value
Superfamily C2 domain (Calcium/lipid-binding domain, CaLB) 0.00108
Family PLC-like (P variant) 0.06
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000341489   Gene: ENSG00000105137   Transcript: ENST00000342784
Sequence length 735
Comment pep:known chromosome:GRCh37:19:15218214:15225789:1 gene:ENSG00000105137 transcript:ENST00000342784 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAEPLLRKTFSRLRGREKLPRKKSDAKERGHPAQRPEPSPPEPEPQAPEGSQAGAEGPSS
PEASRSPARGAYLQSLEPSSRRWVLGGAKPAEDTSLGPGVPGTGEPAGEIWYNPIPEEDP
RPPAPEPPGPQPGSAESEGLAPQGAAPASPPTKASRTKSPGPARRLSIKMKKLPELRRRL
SLRGPRAGRERERAAPAGSVISRYHLDSSVGGPGPAAGPGGTRSPRAGYLSDGDSPERPA
GPPSPTSFRPYEVGPAARAPPAALWGRLSLHLYGLGGLRPAPGATPRDLCCLLQVDGEAR
ARTGPLRGGPDFLRLDHTFHLELEAARLLRALVLAWDPGVRRHRPCAQGTVLLPTVFRGC
QAQQLAVRLEPQGLLYAKLTLSEQQEAPATAEPRVFGLPLPLLVERERPPGQVPLIIQKC
VGQIERRGLRVVGLYRLCGSAAVKKELRDAFERDSAAVCLSEDLYPDINVITGILKDYLR
ELPTPLITQPLYKVVLEAMARDPPNRVPPTTEGTRGLLSCLPDVERATLTLLLDHLRLVS
SFHAYNRMTPQNLAVCFGPVLLPARQAPTRPRARSSGPGLASAVDFKHHIEVLHYLLQSW
PDPRLPRQSPDVAPYLRPKRQPPLHLPLADPEVVTRPRGRGGPESPPSNRYAGDWSVCGR
DFLPCGRDFLSGPDYDHVTGSDSEDEDEEVGEPRVTGDFEDDFDAPFNPHLNLKDFDALI
LDLERELSKQINVCL
Download sequence
Identical sequences Q6ZW31
ENSP00000341489 gi|42475970|ref|NP_149014.3| NP_149014.3.87134 NP_149014.3.92137 ENSP00000341489 ENSP00000341489 9606.ENSP00000341489

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]