SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000342204 from Homo sapiens 69_37

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000342204
Domain Number 1 Region: 639-823
Classification Level Classification E-value
Superfamily DBL homology domain (DH-domain) 2.09e-53
Family DBL homology domain (DH-domain) 0.000000201
Further Details:      
 
Domain Number 2 Region: 831-960
Classification Level Classification E-value
Superfamily PH domain-like 1.75e-35
Family Pleckstrin-homology domain (PH domain) 0.0000159
Further Details:      
 
Domain Number 3 Region: 328-466
Classification Level Classification E-value
Superfamily Spectrin repeat 0.000000196
Family Spectrin repeat 0.011
Further Details:      
 
Domain Number 4 Region: 135-231
Classification Level Classification E-value
Superfamily CRAL/TRIO domain 0.00000628
Family CRAL/TRIO domain 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000342204   Gene: ENSG00000101977   Transcript: ENST00000338585
Sequence length 1070
Comment pep:known chromosome:GRCh37:X:138664630:138724677:-1 gene:ENSG00000101977 transcript:ENST00000338585 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPQAAASAPWTSVSCGRIPGLPQNPDGCTFMPIAQAIPLQVDMAMALQRVRIAEKYGKNY
LCLLQAVFVAETDLLLRIKDISHFLMQDIAFLSGGRGKDNAWIITFPENCNFRCIPEEVI
AKVLTYLTSIARQNGSDSRFTIILDRRLDTWSSLKISLQKISASFPGNLHLVLVLRPTSF
LQRTFTDIGFWFSQEDFMLKLPVVMLSSVSDLLTYIDDKQLTPELGGTLQYCHSEWIIFR
NAIENFALTVKEMAQMLQSFGTELAETELPDDIPSIEEILAIRAERYHLLKNDITAVTKE
GKILLTNLEVPDTEGAVSSRLECHRQISGDWQTINKLLTQVHDMETAFDGFWEKHQLKME
QYLQLWKFEQDFQQLVTEVEFLLNQQAELADVTGTIAQVKQKIKKLENLDENSQELLSKA
QFVILHGHKLAANHHYALDLICQRCNELRYLSDILVNEIKAKRIQLSRTFKMHKLLQQAR
QCCDEGECLLANQEIDKFQSKEDAQKALQDIENFLEMALPFINYEPETLQYEFDVILSPE
LKVQMKTIQLKLENIRSIFENQQAGFRNLADKHVRPIQFVVPTPENLVTSGTPFFSSKQG
KKTWRQNQSNLKIEVVPDCQEKRSSGPSSSLDNGNSLDVLKNHVLNELIQTERVYVRELY
TVLLGYRAEMDNPEMFDLMPPLLRNKKDILFGNMAEIYEFHNDIFLSSLENCAHAPERVG
PCFLERKDDFQMYAKYCQNKPRSETIWRKYSECAFFQECQRKLKHRLRLDSYLLKPVQRI
TKYQLLLKELLKYSKDCEGSALLKKALDAMLDLLKSVNDSMHQIAINGYIGNLNELGKMI
MQGGFSVWIGHKKGATKMKDLARFKPMQRHLFLYEKAIVFCKRRVESGEGSDRYPSYSFK
HCWKMDEVGITEYVKGDNRKFEIWYGEKEEVYIVQASNVDVKMTWLKEIRNILLKQQELL
TVKKRKQQDQLTERDKFQISLQQNDEKQQGAFISTEETELEHTSTVVEVCEAIASVQAEA
NTVWTEASQSAEISEEPAEWSSNYFYPTYDENEEENRPLMRPVSEMALLY
Download sequence
Identical sequences ENSP00000359610 ENSP00000342204

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]