SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000343745 from Homo sapiens 69_37

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000343745
Domain Number 1 Region: 1666-1759,1798-1847
Classification Level Classification E-value
Superfamily RNase III domain-like 8.78e-42
Family RNase III catalytic domain-like 0.001
Further Details:      
 
Domain Number 2 Region: 1293-1370,1549-1595
Classification Level Classification E-value
Superfamily RNase III domain-like 1.68e-30
Family RNase III catalytic domain-like 0.0087
Further Details:      
 
Domain Number 3 Region: 57-212,435-553
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 1.17e-29
Family Tandem AAA-ATPase domain 0.0082
Further Details:      
 
Domain Number 4 Region: 928-991,1026-1040
Classification Level Classification E-value
Superfamily PDB 4.89e-16
Family PDB 0.0042
Further Details:      
 
Domain Number 5 Region: 931-992,1031-1043
Classification Level Classification E-value
Superfamily PAZ domain 0.00000000000000109
Family PAZ domain 0.05
Further Details:      
 
Domain Number 6 Region: 499-538
Classification Level Classification E-value
Superfamily ECOD 0.0000000000163
Family ECOD 0.0027
Further Details:      
 
Domain Number 7 Region: 1806-1917
Classification Level Classification E-value
Superfamily dsRNA-binding domain-like 0.0000059
Family SCOPe 0.05
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000343745   Gene: ENSG00000100697   Transcript: ENST00000343455
Sequence length 1922
Comment pep:known chromosome:GRCh37:14:95552565:95623759:-1 gene:ENSG00000100697 transcript:ENST00000343455 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MKSPALQPLSMAGLQLMTPASSPMGPFFGLPWQQEAIHDNIYTPRKYQVELLEAALDHNT
IVCLNTGSGKTFIAVLLTKELSYQIRGDFSRNGKRTVFLVNSANQVAQQVSAVRTHSDLK
VGEYSNLEVNASWTKERWNQEFTKHQVLIMTCYVALNVLKNGYLSLSDINLLVFDECHLA
ILDHPYREIMKLCENCPSCPRILGLTASILNGKCDPEELEEKIQKLEKILKSNAETATDL
VVLDRYTSQPCEIVVDCGPFTDRSGLYERLLMELEEALNFINDCNISVHSKERDSTLISK
QILSDCRAVLVVLGPWCADKVAGMMVRELQKYIKHEQEELHRKFLLFTDTFLRKIHALCE
EHFSPASLDLKFVTPKVIKLLEILRKYKPYERQQFESVEWYNNRNQDNYVSWSDSEDDDE
DEEIEEKEKPETNFPSPFTNILCGIIFVERRYTAVVLNRLIKEAGKQDPELAYISSNFIT
GHGIGKNQPRNKQMEAEFRKQEEVLRKFRAHETNLLIATSIVEEGVDIPKCNLVVRFDLP
TEYRSYVQSKGRARAPISNYIMLADTDKIKSFEEDLKTYKAIEKILRNKCSKSVDTGETD
IDPVMDDDDVFPPYVLRPDDGGPRVTINTAIGHINRYCARLPSDPFTHLAPKCRTRELPD
GTFYSTLYLPINSPLRASIVGPPMSCVRLAERVVALICCEKLHKIGELDDHLMPVGKETV
KYEEELDLHDEEETSVPGRPGSTKRRQCYPKAIPECLRDSYPRPDQPCYLYVIGMVLTTP
LPDELNFRRRKLYPPEDTTRCFGILTAKPIPQIPHFPVYTRSGEVTISIELKKSGFMLSL
QMLELITRLHQYIFSHILRLEKPALEFKPTDADSAYCVLPLNVVNDSSTLDIDFKFMEDI
EKSEARIGIPSTKYTKETPFVFKLEDYQDAVIIPRYRNFDQPHRFYVADVYTDLTPLSKF
PSPEYETFAEYYKTKYNLDLTNLNQPLLDVDHTSSRLNLLTPRHLNQKGKALPLSSAEKR
KAKWESLQNKQILVPELCAIHPIPASLWRKAVCLPSILYRLHCLLTAEELRAQTASDAGV
GVRSLPADFRYPNLDFGWKKSIDSKSFISISNSSSAENDNYCKHSTIVPENAAHQGANRT
SSLENHDQMSVNCRTLLSESPGKLHVEVSADLTAINGLSYNQNLANGSYDLANRDFCQGN
QLNYYKQEIPVQPTTSYSIQNLYSYENQPQPSDECTLLSNKYLDGNANKSTSDGSPVMAV
MPGTTDTIQVLKGRMDSEQSPSIGYSSRTLGPNPGLILQALTLSNASDGFNLERLEMLGD
SFLKHAITTYLFCTYPDAHEGRLSYMRSKKVSNCNLYRLGKKKGLPSRMVVSIFDPPVNW
LPPGYVVNQDKSNTDKWEKDEMTKDCMLANGKLDEDYEEEDEEEESLMWRAPKEEADYED
DFLEYDQEHIRFIDNMLMGSGAFVKKISLSPFSTTDSAYEWKMPKKSSLGSMPFSSDFED
FDYSSWDAMCYLDPSKAVEEDDFVVGFWNPSEENCGVDTGKQSISYDLHTEQCIADKSIA
DCVEALLGCYLTSCGERAAQLFLCSLGLKVLPVIKRTDREKALCPTRENFNSQQKNLSVS
CAAASVASSRSSVLKDSEYGCLKIPPRCMFDHPDADKTLNHLISGFENFEKKINYRFKNK
AYLLQAFTHASYHYNTITDCYQRLEFLGDAILDYLITKHLYEDPRQHSPGVLTDLRSALV
NNTIFASLAVKYDYHKYFKAVSPELFHVIDDFVQFQLEKNEMQGMDSELRRSEEDEEKEE
DIEVPKAMGDIFESLAGAIYMDSGMSLETVWQVYYPMMRPLIEKFSANVPRSPVRELLEM
EPETAKFSPAERTYDGKVRVTVEVVGKGKFKGVGRSYRIAKSAAARRALRSLKANQPQVP
NS
Download sequence
Identical sequences Q9UPY3
NP_001258211.1.87134 NP_001258211.1.92137 NP_001278557.1.87134 NP_001278557.1.92137 NP_085124.2.87134 NP_085124.2.92137 NP_803187.1.87134 NP_803187.1.92137 XP_011534901.1.92137 XP_011534902.1.92137 XP_011534903.1.92137 XP_011534904.1.92137 XP_016876609.1.92137 XP_016876610.1.92137 gi|29294649|ref|NP_085124.2| gi|29294651|ref|NP_803187.1| 5zak_A 5zal_A 5zam_A ENSP00000343745 ENSP00000376783 ENSP00000435681 ENSP00000437256 ENSP00000343745 ENSP00000376783 ENSP00000435681 ENSP00000437256 NYSGRC-29294649 ENSP00000343745 9606.ENSP00000343745

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]