SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000344866 from Homo sapiens 69_37

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000344866
Domain Number 1 Region: 326-425,584-680
Classification Level Classification E-value
Superfamily RNI-like 1.94e-25
Family Cyclin A/CDK2-associated p19, Skp2 0.072
Further Details:      
 
Domain Number 2 Region: 204-289
Classification Level Classification E-value
Superfamily F-box domain 2.49e-18
Family F-box domain 0.0025
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000344866   Gene: ENSG00000118564   Transcript: ENST00000341285
Sequence length 691
Comment pep:known chromosome:GRCh37:4:15606162:15657035:-1 gene:ENSG00000118564 transcript:ENST00000341285 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAPFPEEVDVFTAPHWRMKQLVGLYCDKLSKTNFSNNNDFRALLQSLYATFKEFKMHEQI
ENEYIIGLLQQRSQTIYNVHSDNKLSEMLSLFEKGLKNVKNEYEQLNYAKQLKERLEAFT
RDFLPHMKEEEEVFQPMLMEYFTYEELKDIKKKVIAQHCSQKDTAELLRGLSLWNHAEER
QKFFKYSVDEKSDKEAEVSEHSTGITHLPPEVMLSIFSYLNPQELCRCSQVSMKWSQLTK
TGSLWKHLYPVHWARGDWYSGPATELDTEPDDEWVKNRKDESRAFHEWDEDADIDESEES
AEESIAISIAQMEKRLLHGLIHNVLPYVGTSVKTLVLAYSSAVSSKMVRQILELCPNLEH
LDLTQTDISDSAFDSWSWLGCCQSLRHLDLSGCEKITDVALEKISRALGILTSHQSGFLK
TSTSKITSTAWKNKDITMQSTKQYACLHDLTNKGIGEEIDNEHPWTKPVSSENFTSPYVW
MLDAEDLADIEDTVEWRHRNVESLCVMETASNFSCSTSGCFSKDIVGLRTSVCWQQHCAS
PAFAYCGHSFCCTGTALRTMSSLPESSAMCRKAARTRLPRGKDLIYFGSEKSDQETGRVL
LFLSLSGCYQITDHGLRVLTLGGGLPYLEHLNLSGCLTITGAGLQDLVSACPSLNDEYFY
YCDNINGPHADTASGCQNLQCGFRACCRSGE
Download sequence
Identical sequences Q9UKA1
HR3547 gi|16306572|ref|NP_036293.1| NP_036293.1.87134 NP_036293.1.92137 ENSP00000344866 ENSP00000344866 9606.ENSP00000344866 ENSP00000344866

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]