SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000345339 from Homo sapiens 69_37

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000345339
Domain Number 1 Region: 35-124
Classification Level Classification E-value
Superfamily Retrovirus capsid dimerization domain-like 3.25e-41
Family SCAN domain 0.0000378
Further Details:      
 
Domain Number 2 Region: 247-304
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 6.9e-26
Family Classic zinc finger, C2H2 0.0042
Further Details:      
 
Domain Number 3 Region: 303-360
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.02e-23
Family Classic zinc finger, C2H2 0.0031
Further Details:      
 
Domain Number 4 Region: 347-406
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 7.47e-19
Family Classic zinc finger, C2H2 0.0045
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000345339   Gene: ENSG00000235109   Transcript: ENST00000344279
Sequence length 406
Comment pep:known chromosome:GRCh37:6:28292724:28303942:-1 gene:ENSG00000235109 transcript:ENST00000344279 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MASTEEQYDLKIVKVEEDPIWDQETHLRGNNFSGQEASRQLFRQFCYQETPGPREALSRL
RELCHQWLRPEIHTKEQILELLVLEQFLTILPEELQAWVREHHPESGEEAVAVVEDLEQE
LSEPGNQAPDHEHGHSEVLLEDVEHLKVKQEPTDIQLQPMVTQLRYESFCLHQFQEQDGE
SIPENQELASKQEILKEMEHLGDSKLQRDVSLDSKYRETCKRDSKAEKQQAHSTGERRHR
CNECGKSFTKSSVLIEHQRIHTGEKPYECEECGKAFSRRSSLNEHRRSHTGEKPYQCKEC
GKAFSASNGLTRHRRIHTGEKPYECKVCGKAFLLSSCLVQHQRIHTGEKRYQCRECGKAF
IQNAGLFQHLRVHTGEKPYQCSQCSKLFSKRTLLKKHQKIHTGERP
Download sequence
Identical sequences A0A024RCL4 Q96LW9
ENSP00000345339 ENSP00000345339 ENSP00000380050 ENSP00000390076 ENSP00000413705 gi|206725428|ref|NP_001128687.1| gi|206725430|ref|NP_001128688.1| gi|206725432|ref|NP_112161.3| gi|41281749|ref|NP_665916.1| ENSP00000345339 ENSP00000380050 ENSP00000390076 ENSP00000413705 NP_001128687.1.87134 NP_001128687.1.92137 NP_001128688.1.87134 NP_001128688.1.92137 NP_001230170.1.87134 NP_001230170.1.92137 NP_112161.3.87134 NP_112161.3.92137 NP_665916.1.87134 NP_665916.1.92137 XP_005249352.1.92137 XP_005249353.1.92137 XP_011513109.1.92137 XP_011513110.1.92137 XP_011513111.1.92137 XP_011513113.1.92137 XP_011513114.1.92137 XP_011513115.1.92137 XP_016866685.1.92137 9606.ENSP00000345339

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]