SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000347850 from Homo sapiens 69_37

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000347850
Domain Number 1 Region: 46-135
Classification Level Classification E-value
Superfamily Retrovirus capsid dimerization domain-like 5.04e-39
Family SCAN domain 0.0000412
Further Details:      
 
Domain Number 2 Region: 377-434
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 5.35e-28
Family Classic zinc finger, C2H2 0.0029
Further Details:      
 
Domain Number 3 Region: 433-490
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.8e-26
Family Classic zinc finger, C2H2 0.0032
Further Details:      
 
Domain Number 4 Region: 321-378
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.32e-23
Family Classic zinc finger, C2H2 0.0046
Further Details:      
 
Domain Number 5 Region: 283-335
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.39e-20
Family Classic zinc finger, C2H2 0.0049
Further Details:      
 
Domain Number 6 Region: 475-527
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.58e-19
Family Classic zinc finger, C2H2 0.0041
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000347850   Gene: ENSG00000186812   Transcript: ENST00000355632
Sequence length 534
Comment pep:putative chromosome:GRCh37:18:32821019:32839191:1 gene:ENSG00000186812 transcript:ENST00000355632 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAVESGVISTLIPQDPPEQELILVKVEDNFSWDEKFKQNGSTQSCQELFRQQFRKFCYQE
TPGPREALSRLQELCYQWLMPELHTKEQILELLVLEQFLSILPEELQIWVQQHNPESGEE
AVTLLEDLEREFDDPGQQVPASPQGPAVPWKDLTCLRASQESTDIHLQPLKTQLKSWKPC
LSPKSDCENSETATKEGISEEKSQGLPQEPSFRGISEHESNLVWKQGSATGEKLRSPSQG
GSFSQVIFTNKSLGKRDLYDEAERCLILTTDSIMCQKVPPEERPYRCDVCGHSFKQHSSL
TQHQRIHTGEKPYKCNQCGKAFSLRSYLIIHQRIHSGEKAYECSECGKAFNQSSALIRHR
KIHTGEKACKCNECGKAFSQSSYLIIHQRIHTGEKPYECNECGKTFSQSSKLIRHQRIHT
GERPYECNECGKAFRQSSELITHQRIHSGEKPYECSECGKAFSLSSNLIRHQRIHSGEEP
YQCNECGKTFKRSSALVQHQRIHSGDEAYICNECGKAFRHRSVLMRHQRVHTIK
Download sequence
Identical sequences Q8NF99
ENSP00000347850 gi|206597472|ref|NP_001128650.1| NP_001128650.1.87134 NP_001128650.1.92137 XP_011524533.1.92137 XP_016881531.1.92137 9606.ENSP00000331577 ENSP00000331577 ENSP00000331577

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]