SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000347927 from Homo sapiens 69_37

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000347927
Domain Number 1 Region: 80-284
Classification Level Classification E-value
Superfamily Metalloproteases ("zincins"), catalytic domain 1.1e-42
Family Reprolysin-like 0.0051
Further Details:      
 
Domain Number 2 Region: 382-438
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.00000000000000615
Family TSP-1 type 1 repeat 0.00037
Further Details:      
 
Domain Number 3 Region: 1066-1130
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.0000000301
Family TSP-1 type 1 repeat 0.0037
Further Details:      
 
Domain Number 4 Region: 737-804
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.000000051
Family TSP-1 type 1 repeat 0.0057
Further Details:      
 
Domain Number 5 Region: 1018-1072
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.00000106
Family TSP-1 type 1 repeat 0.0085
Further Details:      
 
Domain Number 6 Region: 1295-1405
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 0.00000628
Family Spermadhesin, CUB domain 0.017
Further Details:      
 
Domain Number 7 Region: 948-1012
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.0000275
Family TSP-1 type 1 repeat 0.0044
Further Details:      
 
Domain Number 8 Region: 1189-1274
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 0.0000314
Family Spermadhesin, CUB domain 0.0096
Further Details:      
 
Weak hits

Sequence:  ENSP00000347927
Domain Number - Region: 683-742
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.0017
Family TSP-1 type 1 repeat 0.0097
Further Details:      
 
Domain Number - Region: 899-951
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.0366
Family TSP-1 type 1 repeat 0.008
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000347927   Gene: ENSG00000160323   Transcript: ENST00000355699
Sequence length 1427
Comment pep:known chromosome:GRCh37:9:136287444:136324508:1 gene:ENSG00000160323 transcript:ENST00000355699 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MHQRHPRARCPPLCVAGILACGFLLGCWGPSHFQQSCLQALEPQAVSSYLSPGAPLKGRP
PSPGFQRQRQRQRRAAGGILHLELLVAVGPDVFQAHQEDTERYVLTNLNIGAELLRDPSL
GAQFRVHLVKMVILTEPEGAPNITANLTSSLLSVCGWSQTINPEDDTDPGHADLVLYITR
FDLELPDGNRQVRGVTQLGGACSPTWSCLITEDTGFDLGVTIAHEIGHSFGLEHDGAPGS
GCGPSGHVMASDGAAPRAGLAWSPCSRRQLLSLLSAGRARCVWDPPRPQPGSAGHPPDAQ
PGLYYSANEQCRVAFGPKAVACTFAREHLDMCQALSCHTDPLDQSSCSRLLVPLLDGTEC
GVEKWCSKGRCRSLVELTPIAAVHGRWSSWGPRSPCSRSCGGGVVTRRRQCNNPRPAFGG
RACVGADLQAEMCNTQACEKTQLEFMSQQCARTDGQPLRSSPGGASFYHWGAAVPHSQGD
ALCRHMCRAIGESFIMKRGDSFLDGTRCMPSGPREDGTLSLCVSGSCRTFGCDGRMDSQQ
VWDRCQVCGGDNSTCSPRKGSFTAGRAREYVTFLTVTPNLTSVYIANHRPLFTHLAVRIG
GRYVVAGKMSISPNTTYPSLLEDGRVEYRVALTEDRLPRLEEIRIWGPLQEDADIQVYRR
YGEEYGNLTRPDITFTYFQPKPRQAWVWAAVRGPCSVSCGAGLRWVNYSCLDQARKELVE
TVQCQGSQQPPAWPEACVLEPCPPYWAVGDFGPCSASCGGGLRERPVRCVEAQGSLLKTL
PPARCRAGAQQPAVALETCNPQPCPARWEVSEPSSCTSAGGAGLALENETCVPGADGLEA
PVTEGPGSVDEKLPAPEPCVGMSCPPGWGHLDATSAGEKAPSPWGSIRTGAQAAHVWTPA
AGSCSVSCGRGLMELRFLCMDSALRVPVQEELCGLASKPGSRREVCQAVPCPARWQYKLA
ACSVSCGRGVVRRILYCARAHGEDDGEEILLDTQCQGLPRPEPQEACSLEPCPPRWKVMS
LGPCSASCGLGTARRSVACVQLDQGQDVEVDEAACAALVRPEASVPCLIADCTYRWHVGT
WMECSVSCGDGIQRRRDTCLGPQAQAPVPADFCQHLPKPVTVRGCWAGPCVGQGTPSLVP
HEEAAAPGRTTATPAGASLEWSQARGLLFSPAPQPRRLLPGPQENSVQSSACGRQHLEPT
GTIDMRGPGQADCAVAIGRPLGEVVTLRVLESSLNCSAGDMLLLWGRLTWRKMCRKLLDM
TFSSKTNTLVVRQRCGRPGGGVLLRYGSQLAPETFYRECDMQLFGPWGEIVSPSLSPATS
NAGGCRLFINVAPHARIAIHALATNMGAGTEGANASYILIRDTHSLRTTAFHGQQVLYWE
SESSQAEMEFSEGFLKAQASLRGQYWTLQSWVPEMQDPQSWKGKEGT
Download sequence
Identical sequences Q76LX8
ENSP00000347927 ENSP00000454450 ENSP00000360997 gi|21265034|ref|NP_620594.1| ENSP00000360997 ENSP00000456186 MPIB NP_620594.1.87134 NP_620594.1.92137 9606.ENSP00000360997

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]