SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000348602 from Homo sapiens 69_37

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000348602
Domain Number 1 Region: 26-231
Classification Level Classification E-value
Superfamily BAR/IMD domain-like 1.11e-61
Family BAR domain 0.00000833
Further Details:      
 
Domain Number 2 Region: 617-694
Classification Level Classification E-value
Superfamily SH3-domain 0.00000000000000214
Family SH3-domain 0.0000764
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000348602   Gene: ENSG00000078053   Transcript: ENST00000356264
Sequence length 695
Comment pep:known chromosome:GRCh37:7:38423305:38671167:-1 gene:ENSG00000078053 transcript:ENST00000356264 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MADIKTGIFAKNVQKRLNRAQEKVLQKLGKADETKDEQFEEYVQNFKRQEAEGTRLQREL
RGYLAAIKGMQEASMKLTESLHEVYEPDWYGREDVKMVGEKCDVLWEDFHQKLVDGSLLT
LDTYLGQFPDIKNRIAKRSRKLVDYDSARHHLEALQSSKRKDESRISKAEEEFQKAQKVF
EEFNVDLQEELPSLWSRRVGFYVNTFKNVSSLEAKFHKEIAVLCHKLYEVMTKLGDQHAD
KAFTIQGAPSDSGPLRIAKTPSPPEEPSPLPSPTASPNHTLAPASPAPARPRSPSQTRKG
PPVPPLPKVTPTKELQQENIISFFEDNFVPEISVTTPSQNEVPEVKKEETLLDLDFDPFK
PEVTPAGSAGVTHSPMSQTLPWDLWTTSTDLVQPASGGSFNGFTQPQDTSLFTMQTDQSM
ICNLAESEQAPPTEPKAEEPLAAVTPAVGLDLGMDTRAEEPVEEAVIIPGADADAAVGTL
VSAAEGAPGEEAEAEKATVPAGEGVSLEEAKIGTETTEGAESAQPEAEELEATVPQEKVI
PSVVIEPASNHEEEGENEITIGAEPKETTEDAAPPGPTSETPELATEQKPIQDPQPTPSA
PAMGAADQLASAREASQELPPGFLYKVETLHDFEAANSDELTLQRGDVVLVVPSDSEADQ
DAGWLVGVKESDWLQYRDLATYKGLFPENFTRRLD
Download sequence
Identical sequences P49418
NP_001626.1.87134 NP_001626.1.92137 ENSP00000348602 ENSP00000348602 gi|4502081|ref|NP_001626.1| ENSP00000348602 9606.ENSP00000348602

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]