SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000350018 from Homo sapiens 69_37

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000350018
Domain Number 1 Region: 18-161,190-253
Classification Level Classification E-value
Superfamily BAR/IMD domain-like 1.02e-49
Family BAR domain 0.0069
Further Details:      
 
Domain Number 2 Region: 273-469
Classification Level Classification E-value
Superfamily GTPase activation domain, GAP 2.55e-49
Family BCR-homology GTPase activation domain (BH-domain) 0.00012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000350018   Gene: ENSG00000100092   Transcript: ENST00000357436
Sequence length 701
Comment pep:known chromosome:GRCh37:22:38035482:38052124:1 gene:ENSG00000100092 transcript:ENST00000357436 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MMKRQLHRMRQLAQTGSLGRTPETAEFLGEDLLQVEQRLEPAKRAAHNIHKRLQACLQGQ
SGADMDKRVKKLPLMALSTTMAESFKELDPDSSMGKALEMSCAIQNQLARILAEFEMTLE
RDVLQPLSRLSEEELPAILKHKKSLQKLVSDWNTLKSRLSQATKNSGSSQGLGGSPGSHS
HTTMANKVETLKEEEEELKRKVEQCRDEYLADLYHFVTKEDSYANYFIRLLEIQADYHRR
SLSSLDTALAELRENHGQADHSPSMTATHFPRVYGVSLATHLQELGREIALPIEACVMML
LSEGMKEEGLFRLAAGASVLKRLKQTMASDPHSLEEFCSDPHAVAGALKSYLRELPEPLM
TFDLYDDWMRAASLKEPGARLQALQEVCSRLPPENLSNLRYLMKFLARLAEEQEVNKMTP
SNIAIVLGPNLLWPPEKEGDQAQLDAASVSSIQVVGVVEALIQSADTLFPGDINFNVSGL
FSAVTLQDTVSDRLASEELPSTAVPTPATTPAPAPAPAPAPAPALASAATKERTESEVPP
RPASPKVTRSPPETAAPVEDMARRTKRPAPARPTMPPPQVSGSRSSPPAPPLPPGSGSPG
TPQALPRRLVGSSLRAPTVPPPLPPTPPQPARRQSRRSPASPSPASPGPASPSPVSLSNP
AQVDLGAATAEGGAPEAISGVPTPPAIPPQPRPRSLASETN
Download sequence
Identical sequences Q9Y3L3
ENSP00000350018 ENSP00000350018 ENSP00000350018 9606.ENSP00000350018 NP_061830.3.87134 NP_061830.3.92137 HR3580 gi|85815829|ref|NP_061830.3|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]