SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000350480 from Homo sapiens 69_37

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000350480
Domain Number 1 Region: 24-186,213-337
Classification Level Classification E-value
Superfamily BAR/IMD domain-like 4.6e-63
Family FCH domain 0.0022
Further Details:      
 
Domain Number 2 Region: 499-694
Classification Level Classification E-value
Superfamily GTPase activation domain, GAP 1.55e-55
Family BCR-homology GTPase activation domain (BH-domain) 0.0000654
Further Details:      
 
Domain Number 3 Region: 743-805
Classification Level Classification E-value
Superfamily SH3-domain 8.95e-16
Family SH3-domain 0.0012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000350480   Gene: ENSG00000196935   Transcript: ENST00000357825
Sequence length 1085
Comment pep:known chromosome:GRCh37:12:64238541:64541613:1 gene:ENSG00000196935 transcript:ENST00000357825 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSTPSRFKKDKEIIAEYESQVKEIRAQLVEQQKCLEQQTEMRVQLLQDLQDFFRKKAEIE
TEYSRNLEKLAERFMAKTRSTKDHQQYKKDQNLLSPVNCWYLLLNQVRRESKDHATLSDI
YLNNVIMRFMQISEDSTRMFKKSKEIAFQLHEDLMKVLNELYTVMKTYHMYHAESISAES
KLKEAEKQEEKQIGRSGDPVFHIRLEERHQRRSSVKKIEKMKEKRQAKYSENKLKSIKAR
NEYLLTLEATNASVFKYYIHDLSDLIDCCDLGYHASLNRALRTYLSAEYNLETSRHEGLD
IIENAVDNLEPRSDKQRFMEMYPAAFCPPMKFEFQSHMGDEVCQVSAQQPVQAELMLRYQ
QLQSRLATLKIENEEVKKTTEATLQTIQDMVTIEDYDVSECFQHSRSTESVKSTVSETYL
SKPSIAKRRANQQETEQFYFMKLREYLEGSNLITKLQAKHDLLQRTLGEGHRAEYMTTRP
PNVPPKPQKHRKSRPRSQYNTKLFNGDLETFVKDSGQVIPLIVESCIRFINLYGLQHQGI
FRVSGSQVEVNDIKNSFERGENPLADDQSNHDINSVAGVLKLYFRGLENPLFPKERFNDL
ISCIRIDNLYERALHIRKLLLTLPRSVLIVMRYLFAFLNHLSQYSDENMMDPYNLAICFG
PTLMPVPEIQDQVSCQAHVNEIIKTIIIHHETIFPDAKELDGPVYEKCMAGDDYCDSPYS
EHGTLEEVDQDAGTEPHTSEDECEPIEAIAKFDYVGRSARELSFKKGASLLLYHRASEDW
WEGRHNGIDGLVPHQYIVVQDMDDTFSDTLSQKADSEASSGPVTEDKSSSKDMNSPTDRH
PDGYLARQRKRGEPPPPVRRPGRTSDGHCPLHPPHALSNSSVDLGSPSLASHPRGLLQNR
GLNNDSPERRRRPGHGSLTNISRHDSLKKIDSPPIRRSTSSGQYTGFNDHKPLDPETIAQ
DIEETMNTALNELRELERQSTAKHAPDVVLDTLEQVKNSPTPATSTESLSPLHNVALRSS
EPQIRRSTSSSSDTMSTFKPMVAPRMGVQLKPPALRPKPAVLPKTNPTIGPAPPPQGPTD
KSCTM
Download sequence
Identical sequences A0A0D9QWU6 A0A2I3MQK2 A0A2K5MYI2 A0A2K5VDR1 G3QCX6 G7N7I9 Q7Z6B7
NP_065813.1.87134 NP_065813.1.92137 XP_004053545.1.27298 XP_005571492.1.63531 XP_008002082.1.81039 XP_011947278.1.92194 XP_015007689.1.72884 9606.ENSP00000347198 ENSP00000347198 gi|44917604|ref|NP_065813.1| ENSP00000350480 ENSGGOP00000000078 ENSP00000347198 ENSGGOP00000000078 HR4511 NYSGXRC-13141a hso003011181.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]