SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000350716 from Homo sapiens 69_37

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSP00000350716
Domain Number - Region: 53-108
Classification Level Classification E-value
Superfamily Myosin rod fragments 0.00628
Family Myosin rod fragments 0.017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000350716   Gene: ENSG00000198680   Transcript: ENST00000358022
Sequence length 212
Comment pep:known chromosome:GRCh37:9:25676396:25678856:-1 gene:ENSG00000198680 transcript:ENST00000358022 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGPMWRMRGGATRRGSCCGGDGAADGRGPGRSGRARGGGSPSGGGGGVGWRGRADGARQQ
LEERFADLAASHLEAIRARDEWDRQNARLRQENARLRLENRRLKRENRSLFRQALRLPGE
GGNGTPAEARRVPEEASTNRRARDSGREDEPGSPRALRARLEKLEAMYRRALLQLHLEQR
GPRPSGDKEEQPLQEPDSGLRSRDSEPSGPWL
Download sequence
Identical sequences Q2TAM9
NP_001004125.1.87134 NP_001004125.1.92137 ENSP00000350716 ENSP00000350716 gi|51944974|ref|NP_001004125.1| ENSP00000350716 9606.ENSP00000350716

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]