SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000350765 from Homo sapiens 69_37

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000350765
Domain Number 1 Region: 8-236
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 3.9e-79
Family Calponin-homology domain, CH-domain 0.000000611
Further Details:      
 
Domain Number 2 Region: 3085-3208
Classification Level Classification E-value
Superfamily EF-hand 9.08e-53
Family EF-hand modules in multidomain proteins 0.000000572
Further Details:      
 
Domain Number 3 Region: 3210-3306
Classification Level Classification E-value
Superfamily EF-hand 6.8e-40
Family EF-hand modules in multidomain proteins 0.00000394
Further Details:      
 
Domain Number 4 Region: 2051-2208
Classification Level Classification E-value
Superfamily Spectrin repeat 2.02e-23
Family Spectrin repeat 0.0035
Further Details:      
 
Domain Number 5 Region: 999-1152
Classification Level Classification E-value
Superfamily Spectrin repeat 3.28e-23
Family Spectrin repeat 0.0047
Further Details:      
 
Domain Number 6 Region: 2159-2316
Classification Level Classification E-value
Superfamily Spectrin repeat 1.11e-21
Family Spectrin repeat 0.004
Further Details:      
 
Domain Number 7 Region: 3286-3374
Classification Level Classification E-value
Superfamily RING/U-box 3.06e-21
Family ZZ domain 0.0092
Further Details:      
 
Domain Number 8 Region: 2525-2680
Classification Level Classification E-value
Superfamily Spectrin repeat 8.92e-20
Family Spectrin repeat 0.0088
Further Details:      
 
Domain Number 9 Region: 1103-1263
Classification Level Classification E-value
Superfamily Spectrin repeat 1.37e-19
Family Spectrin repeat 0.0063
Further Details:      
 
Domain Number 10 Region: 336-446
Classification Level Classification E-value
Superfamily Spectrin repeat 6.02e-18
Family Spectrin repeat 0.0033
Further Details:      
 
Domain Number 11 Region: 1213-1367
Classification Level Classification E-value
Superfamily Spectrin repeat 1.7e-17
Family Spectrin repeat 0.0038
Further Details:      
 
Domain Number 12 Region: 2752-2878
Classification Level Classification E-value
Superfamily Spectrin repeat 6.27e-17
Family Spectrin repeat 0.005
Further Details:      
 
Domain Number 13 Region: 2901-3039
Classification Level Classification E-value
Superfamily Spectrin repeat 1.57e-16
Family Spectrin repeat 0.0072
Further Details:      
 
Domain Number 14 Region: 522-660
Classification Level Classification E-value
Superfamily Spectrin repeat 5.76e-16
Family Spectrin repeat 0.0043
Further Details:      
 
Domain Number 15 Region: 1519-1674
Classification Level Classification E-value
Superfamily Spectrin repeat 6.91e-16
Family Spectrin repeat 0.0055
Further Details:      
 
Domain Number 16 Region: 1628-1772
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0000000000000936
Family Spectrin repeat 0.0067
Further Details:      
 
Domain Number 17 Region: 1823-1967
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0000000000022
Family Spectrin repeat 0.0051
Further Details:      
 
Domain Number 18 Region: 455-556
Classification Level Classification E-value
Superfamily Spectrin repeat 0.00000000000738
Family Spectrin repeat 0.0044
Further Details:      
 
Domain Number 19 Region: 3047-3084
Classification Level Classification E-value
Superfamily WW domain 0.0000000000341
Family WW domain 0.00012
Further Details:      
 
Domain Number 20 Region: 720-827
Classification Level Classification E-value
Superfamily Spectrin repeat 0.000000000144
Family Spectrin repeat 0.0038
Further Details:      
 
Domain Number 21 Region: 776-931
Classification Level Classification E-value
Superfamily Spectrin repeat 0.000000000192
Family Spectrin repeat 0.013
Further Details:      
 
Domain Number 22 Region: 2284-2421
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0000000207
Family Spectrin repeat 0.0064
Further Details:      
 
Domain Number 23 Region: 2471-2539
Classification Level Classification E-value
Superfamily Spectrin repeat 0.00000575
Family Spectrin repeat 0.0048
Further Details:      
 
Weak hits

Sequence:  ENSP00000350765
Domain Number - Region: 916-1008
Classification Level Classification E-value
Superfamily Spectrin repeat 0.000827
Family Spectrin repeat 0.014
Further Details:      
 
Domain Number - Region: 1427-1534
Classification Level Classification E-value
Superfamily Spectrin repeat 0.046
Family Spectrin repeat 0.015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000350765   Gene: ENSG00000198947   Transcript: ENST00000358062
Sequence length 3685
Comment pep:novel chromosome:GRCh37:X:31137338:31893490:-1 gene:ENSG00000198947 transcript:ENST00000358062 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLWWEEVEDCYEREDVQKKTFTKWVNAQFSKFGKQHIENLFSDLQDGRRLLDLLEGLTGQ
KLPKEKGSTRVHALNNVNKALRVLQNNNVDLVNIGSTDIVDGNHKLTLGLIWNIILHWQV
KNVMKNIMAGLQQTNSEKILLSWVRQSTRNYPQVNVINFTTSWSDGLALNALIHSHRPDL
FDWNSVVCQQSATQRLEHAFNIARYQLGIEKLLDPEDVDTTYPDKKSILMYITSLFQVLP
QQVSIEAIQEVEMLPRPPKVTKEEHFQLHHQMHYSQQITVSLAQGYERTSSPKPRFKSYA
YTQAAYVTTSDPTRSPFPSQHLEAPEDKSFGSSLMESEVNLDRYQTALEEVLSWLLSAED
TLQAQGEISNDVEVVKDQFHTHEGYMMDLTAHQGRVGNILQLGSKLIGTGKLSEDEETEV
QEQMNLLNSRWECLRVASMEKQSNLHRVLMDLQNQKLKELNDWLTKTEERTRKMEEEPLG
PDLEDLKRQVQQHKVLQEDLEQEQVRVNSLTHMVVVVDESSGDHATAALEEQLKVLGDRW
ANICRWTEDRWVLLQDILLKWQRLTEEQCLFSAWLSEKEDAVNKIHTTGFKDQNEMLSSL
QKLAVLKADLEKKKQSMGKLYSLKQDLLSTLKNKSVTQKTEAWLDNFARCWDNLVQKLEK
STAQISQAVTTTQPSLTQTTVMETVTTVTTREQILVKHAQEELPPPPPQKKRQITVDSEI
RKRLDVDITELHSWITRSEAVLQSPEFAIFRKEGNFSDLKEKVNAIEREKAEKFRKLQDA
SRSAQALVEQMVNEGVNADSIKQASEQLNSRWIEFCQLLSERLNWLEYQNNIIAFYNQLQ
QLEQMTTTAENWLKIQPTTPSEPTAIKSQLKICKDEVNRLSDLQPQIERLKIQSIALKEK
GQGPMFLDADFVAFTNHFKQVFSDVQAREKELQTIFDTLPPMRYQETMSAIRTWVQQSET
KLSIPQLSVTDYEIMEQRLGELQALQSSLQEQQSGLYYLSTTVKEMSKKAPSEISRKYQS
EFEEIEGRWKKLSSQLVEHCQKLEEQMNKLRKIQNHIQTLKKWMAEVDVFLKEEWPALGD
SEILKKQLKQCRLLVSDIQTIQPSLNSVNEGGQKIKNEAEPEFASRLETELKELNTQWDH
MCQQVYARKEALKGGLEKTVSLQKDLSEMHEWMTQAEEEYLERDFEYKTPDELQKAVEEM
KRAKEEAQQKEAKVKLLTESVNSVIAQAPPVAQEALKKELETLTTNYQWLCTRLNGKCKT
LEEVWACWHELLSYLEKANKWLNEVEFKLKTTENIPGGAEEISEVLDSLENLMRHSEDNP
NQIRILAQTLTDGGVMDELINEELETFNSRWRELHEEAVRRQKLLEQSIQSAQETEKSLH
LIQESLTFIDKQLAAYIADKVDAAQMPQEAQKIQSDLTSHEISLEEMKKHNQGKEAAQRV
LSQIDVAQKKLQDVSMKFRLFQKPANFEQRLQESKMILDEVKMHLPALETKSVEQEVVQS
QLNHCVNLYKSLSEVKSEVEMVIKTGRQIVQKKQTENPKELDERVTALKLHYNELGAKVT
ERKQQLEKCLKLSRKMRKEMNVLTEWLAATDMELTKRSAVEGMPSNLDSEVAWGKATQKE
IEKQKVHLKSITEVGEALKTVLGKKETLVEDKLSLLNSNWIAVTSRAEEWLNLLLEYQKH
METFDQNVDHITKWIIQADTLLDESEKKKPQQKEDVLKRLKAELNDIRPKVDSTRDQAAN
LMANRGDHCRKLVEPQISELNHRFAAISHRIKTGKASIPLKELEQFNSDIQKLLEPLEAE
IQQGVNLKEEDFNKDMNEDNEGTVKELLQRGDNLQQRITDERKREEIKIKQQLLQTKHNA
LKDLRSQRRKKALEISHQWYQYKRQADDLLKCLDDIEKKLASLPEPRDERKIKEIDRELQ
KKKEELNAVRRQAEGLSEDGAAMAVEPTQIQLSKRWREIESKFAQFRRLNFAQIHTVREE
TMMVMTEDMPLEISYVPSTYLTEITHVSQALLEVEQLLNAPDLCAKDFEDLFKQEESLKN
IKDSLQQSSGRIDIIHSKKTAALQSATPVERVKLQEALSQLDFQWEKVNKMYKDRQGRFD
RSVEKWRRFHYDIKIFNQWLTEAEQFLRKTQIPENWEHAKYKWYLKELQDGIGQRQTVVR
TLNATGEEIIQQSSKTDASILQEKLGSLNLRWQEVCKQLSDRKKRLEEQKNILSEFQRDL
NEFVLWLEEADNIASIPLEPGKEQQLKEKLEQVKLLVEELPLRQGILKQLNETGGPVLVS
APISPEEQDKLENKLKQTNLQWIKVSRALPEKQGEIEAQIKDLGQLEKKLEDLEEQLNHL
LLWLSPIRNQLEIYNQPNQEGPFDVKETEIAVQAKQPDVEEILSKGQHLYKEKPATQPVK
RKLEDLSSEWKAVNRLLQELRAKQPDLAPGLTTIGASPTQTVTLVTQPVVTKETAISKLE
MPSSLMLEVPALADFNRAWTELTDWLSLLDQVIKSQRVMVGDLEDINEMIIKQKATMQDL
EQRRPQLEELITAAQNLKNKTSNQEARTIITDRIERIQNQWDEVQEHLQNRRQQLNEMLK
DSTQWLEAKEEAEQVLGQARAKLESWKEGPYTVDAIQKKITETKQLAKDLRQWQTNVDVA
NDLALKLLRDYSADDTRKVHMITENINASWRSIHKRVSEREAALEETHRLLQQFPLDLEK
FLAWLTEAETTANVLQDATRKERLLEDSKGVKELMKQWQDLQGEIEAHTDVYHNLDENSQ
KILRSLEGSDDAVLLQRRLDNMNFKWSELRKKSLNIRSHLEASSDQWKRLHLSLQELLVW
LQLKDDELSRQAPIGGDFPAVQKQNDVHRAFKRELKTKEPVIMSTLETVRIFLTEQPLEG
LEKLYQEPRELPPEERAQNVTRLLRKQAEEVNTEWEKLNLHSADWQRKIDETLERLRELQ
EATDELDLKLRQAEVIKGSWQPVGDLLIDSLQDHLEKVKALRGEIAPLKENVSHVNDLAR
QLTTLGIQLSPYNLSTLEDLNTRWKLLQVAVEDRVRQLHEAHRDFGPASQHFLSTSVQGP
WERAISPNKVPYYINHETQTTCWDHPKMTELYQSLADLNNVRFSAYRTAMKLRRLQKALC
LDLLSLSAACDALDQHNLKQNDQPMDILQIINCLTTIYDRLEQEHNNLVNVPLCVDMCLN
WLLNVYDTGRTGRIRVLSFKTGIISLCKAHLEDKYRYLFKQVASSTGFCDQRRLGLLLHD
SIQIPRQLGEVASFGGSNIEPSVRSCFQFANNKPEIEAALFLDWMRLEPQSMVWLPVLHR
VAAAETAKHQAKCNICKECPIIGFRYRSLKHFNYDICQSCFFSGRVAKGHKMHYPMVEYC
TPTTSGEDVRDFAKVLKNKFRTKRYFAKHPRMGYLPVQTVLEGDNMETPVTLINFWPVDS
APASSPQLSHDDTHSRIEHYASRLAEMENSNGSYLNDSISPNESIDDEHLLIQHYCQSLN
QDSPLSQPRSPAQILISLESEERGELERILADLEEENRNLQAEYDRLKQQHEHKGLSPLP
SPPEMMPTSPQSPRDAELIAEAKLLRQHKGRLEARMQILEDHNKQLESQLHRLRQLLEQP
QAEAKVNGTTVSSPSTSLQRSDSSQPMLLRVVGSQTSDSMGEEDLLSPPQDTSTGLEEVM
EQLNNSFPSSRGRNTPGKPMREDTM
Download sequence
Identical sequences A0A075B6G3
ENSP00000354923 ENSP00000350765 9606.ENSP00000354923 ENSP00000354923

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]