SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000351257 from Homo sapiens 69_37

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000351257
Domain Number 1 Region: 286-343
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 5.57e-26
Family Classic zinc finger, C2H2 0.0043
Further Details:      
 
Domain Number 2 Region: 370-427
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 6.98e-26
Family Classic zinc finger, C2H2 0.0042
Further Details:      
 
Domain Number 3 Region: 454-511
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.31e-24
Family Classic zinc finger, C2H2 0.0051
Further Details:      
 
Domain Number 4 Region: 511-567
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 4.03e-23
Family Classic zinc finger, C2H2 0.0048
Further Details:      
 
Domain Number 5 Region: 556-608
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.71e-21
Family Classic zinc finger, C2H2 0.0039
Further Details:      
 
Domain Number 6 Region: 71-133
Classification Level Classification E-value
Superfamily Retrovirus capsid dimerization domain-like 9.61e-21
Family SCAN domain 0.00029
Further Details:      
 
Domain Number 7 Region: 244-296
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 4.64e-20
Family Classic zinc finger, C2H2 0.0038
Further Details:      
 
Domain Number 8 Region: 209-259
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 3.66e-19
Family Classic zinc finger, C2H2 0.005
Further Details:      
 
Domain Number 9 Region: 333-365
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000000147
Family Classic zinc finger, C2H2 0.01
Further Details:      
 
Domain Number 10 Region: 417-449
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000000349
Family Classic zinc finger, C2H2 0.0086
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000351257   Gene: ENSG00000176371   Transcript: ENST00000358472
Sequence length 614
Comment pep:putative chromosome:GRCh37:15:85144251:85166947:1 gene:ENSG00000176371 transcript:ENST00000358472 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MMAADIPRVTTPLSSLVQVPQEEDRQEEEVTTMILEDDSWVQEAVLQEDGPESEPFPQSA
GKGGPQEEVTRGPQGALGRLRELCRRWLRPEVHTKEQMLTMLPKEIQAWLQEHRPESSEE
AAALVEDLTQTLQDSDFEIQSENGENCNQDMFENESRKIFSEMPEGESAQHSDGESDFER
DAGIQRLQGHSPGEDHGEVVSQDREVGQLIGLQGTYLGEKPYECPQCGKTFSRKSHLITH
ERTHTGEKYYKCDECGKSFSDGSNFSRHQTTHTGEKPYKCRDCGKSFSRSANLITHQRIH
TGEKPFQCAECGKSFSRSPNLIAHQRTHTGEKPYSCPECGKSFGNRSSLNTHQGIHTGEK
PYECKECGESFSYNSNLIRHQRIHTGEKPYKCTDCGQRFSQSSALITHRRTHTGEKPYQC
SECGKSFSRSSNLATHRRTHMVEKPYKCGVCGKSFSQSSSLIAHQGMHTGEKPYECLTCG
ESFSWSSNLLKHQRIHTGEKPYKCSECGKCFSQRSQLVVHQRTHTGEKPYKCLMCGKSFS
RGSILVMHQRAHLGDKPYRCPECGKGFSWNSVLIIHQRIHTGEKPYKCPECGKGFSNSSN
FITHQRTHMKEKLY
Download sequence
Identical sequences Q7Z7L9
ENSP00000410198 ENSP00000441855 ENSP00000445451 ENSP00000410198 ENSP00000441855 ENSP00000445451 gi|63176661|ref|NP_870992.2| NP_870992.2.87134 NP_870992.2.92137 ENSP00000351257 9606.ENSP00000325123

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]