SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000351333 from Homo sapiens 69_37

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000351333
Domain Number 1 Region: 110-308
Classification Level Classification E-value
Superfamily GTPase activation domain, GAP 4.12e-44
Family BCR-homology GTPase activation domain (BH-domain) 0.00052
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000351333   Gene: ENSG00000213390   Transcript: ENST00000358531
Sequence length 517
Comment pep:known chromosome:GRCh37:10:98981930:99052413:-1 gene:ENSG00000213390 transcript:ENST00000358531 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MATEAQSEGEVPARESGRSDAICSFVICNDSSLRGQPIIFNPDFFVEKLRHEKPEIFTEL
VVSNITRLIDLPGTELAQLMGEVDLKLPGGAGPASGFFRSLMSLKRKEKGVIFGSPLTEE
GIAQIYQLIEYLHKNLRVEGLFRVPGNSVRQQILRDALNNGTDIDLESGEFHSNDVATLL
KMFLGELPEPLLTHKHFNAHLKIADLMQFDDKGNKTNIPDKDRQIEALQLLFLILPPPNR
NLLKLLLDLLYQTAKKQDKNKMSAYNLALMFAPHVLWPKNVTANDLQENITKLNSGMAFM
IKHSQKLFKAPAYIRECARLHYLGSRTQASKDDLDLIASCHTKSFQLAKSQKRNRVDSCP
HQEETQHHTEEALRELFQHVHDMPESAKKKQLIRQFNKQSLTQTPGREPSTSQVQKRARS
RSFSGLIKRKVLGNQMMSEKKKKNPTPESVAIGELKGTSKENRNLLFSGSPAVTMTPTRL
KWSEGKKEGKKGNSMATTSLGSIRMTLRGSSSCGCCS
Download sequence
Identical sequences ENSP00000473567 ENSP00000414774 ENSP00000473567 ENSP00000351333

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]