SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000351883 from Homo sapiens 69_37

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000351883
Domain Number 1 Region: 36-121
Classification Level Classification E-value
Superfamily Retrovirus capsid dimerization domain-like 1.65e-29
Family SCAN domain 0.00024
Further Details:      
 
Domain Number 2 Region: 392-448
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.27e-21
Family Classic zinc finger, C2H2 0.014
Further Details:      
 
Domain Number 3 Region: 433-485
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 9.42e-19
Family Classic zinc finger, C2H2 0.0097
Further Details:      
 
Domain Number 4 Region: 354-405
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.69e-17
Family Classic zinc finger, C2H2 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000351883   Gene: ENSG00000197213   Transcript: ENST00000358992
Sequence length 495
Comment pep:known chromosome:GRCh37:19:56701058:56704421:-1 gene:ENSG00000197213 transcript:ENST00000358992 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAANWTLSWGQGGPCNSPGSDTPRSVASPETQLGNHDRNPETWHMNFRMFSCPEESDPIQ
ALRKLTELCHLWLRPDLHTKEQILDMLVMEQFMISMPQELQVLVKVNGVQSCKDLEDLLR
NNRRPKKWSIVNLLGKEYLMLNSDVEMAEAPASVRDDPRDVSSQWASSVNQMHPGTGQAR
REQQILPRVAALSRRQGEDFLLHKSIDVTGDPNSPRPKQTLEKDLKENREENPGLSSPEP
QLPKSPNLVRAKEGKEPQKRASVENVDADTPSACVVEREALTHSGNRGDALNLSSPKRSK
PDASSISQEEPQGEATPVGNRESPGQAEINPVHSPGPAGPVSHPDGQEAKALPPFACDVC
NKSFKYFSQLSIHRRSHTGDRPFQCDLCRKRFLQPSDLRVHQRVHTGERPYMCDVCQKRF
AHESTLQGHKRIHTGERPFKCKYCSKVFSHKGNLNVHQRTHSGEKPYKCPTCQKAFRQLG
TFKRHLKTHRETTSQ
Download sequence
Identical sequences A6NJL1
ENSP00000351883 ENSP00000466072 NP_001073925.2.87134 NP_001073925.2.92137 XP_006723252.1.92137 gi|207028781|ref|NP_001073925.2| 9606.ENSP00000351883 ENSP00000351883 ENSP00000466072 ENSP00000351883

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]