SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000352889 from Homo sapiens 69_37

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSP00000352889
Domain Number - Region: 407-547
Classification Level Classification E-value
Superfamily Toll/Interleukin receptor TIR domain 0.0392
Family Toll/Interleukin receptor TIR domain 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000352889   Gene: ENSG00000056972   Transcript: ENST00000359831
Sequence length 574
Comment pep:known chromosome:GRCh37:6:111880143:111927074:-1 gene:ENSG00000056972 transcript:ENST00000359831 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPPQLQETRMNRSIPVEVDESEPYPSQLLKPIPEYSPEEESEPPAPNIRNMAPNSLSAPT
MLHNSSGDFSQAHSTLKLANHQRPVSRQVTCLRTQVLEDSEDSFCRRHPGLGKAFPSGCS
AVSEPASESVVGALPAEHQFSFMEKRNQWLVSQLSAASPDTGHDSDKSDQSLPNASADSL
GGSQEMVQRPQPHRNRAGLDLPTIDTGYDSQPQDVLGIRQLERPLPLTSVCYPQDLPRPL
RSREFPQFEPQRYPACAQMLPPNLSPHAPWNYHYHCPGSPDHQVPYGHDYPRAAYQQVIQ
PALPGQPLPGASVRGLHPVQKVILNYPSPWDHEERPAQRDCSFPGLPRHQDQPHHQPPNR
AGAPGESLECPAELRPQVPQPPSPAAVPRPPSNPPARGTLKTSNLPEELRKVFITYSMDT
AMEVVKFVNFLLVNGFQTAIDIFEDRIRGIDIIKWMERYLRDKTVMIIVAISPKYKQDVE
GAESQLDEDEHGLHTKYIHRMMQIEFIKQGSMNFRFIPVLFPNAKKEHVPTWLQNTHVYS
WPKNKKNILLRLLREEEYVAPPRGPLPTLQVVPL
Download sequence
Identical sequences O43734
ENSP00000345984 ENSP00000352889 9606.ENSP00000345984 NP_671733.2.87134 NP_671733.2.92137 XP_011533688.1.92137 ENSP00000345984 ENSP00000376339

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]