SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000354305 from Homo sapiens 69_37

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000354305
Domain Number 1 Region: 40-131
Classification Level Classification E-value
Superfamily Retrovirus capsid dimerization domain-like 8.7e-41
Family SCAN domain 0.0000324
Further Details:      
 
Domain Number 2 Region: 505-562
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 5.31e-26
Family Classic zinc finger, C2H2 0.0046
Further Details:      
 
Domain Number 3 Region: 282-339
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.16e-24
Family Classic zinc finger, C2H2 0.005
Further Details:      
 
Domain Number 4 Region: 453-506
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 6e-24
Family Classic zinc finger, C2H2 0.0062
Further Details:      
 
Domain Number 5 Region: 394-451
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 5.04e-21
Family Classic zinc finger, C2H2 0.0074
Further Details:      
 
Domain Number 6 Region: 338-395
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.44e-20
Family Classic zinc finger, C2H2 0.0055
Further Details:      
 
Domain Number 7 Region: 246-296
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000000419
Family Classic zinc finger, C2H2 0.0054
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000354305   Gene: ENSG00000158691   Transcript: ENST00000361028
Sequence length 604
Comment pep:known chromosome:GRCh37:6:28346732:28367511:-1 gene:ENSG00000158691 transcript:ENST00000361028 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MASTWAIQAHMDQDEPLEVKIEEEKYTTRQDWDLRKNNTHSREVFRQYFRQFCYQETSGP
REALSRLRELCHQWLRPETHTKEQILELLVLEQFLTILPEELQAWVQEQHPESGEEVVTV
LEDLERELDEPGEQVSVHTGEQEMFLQETVRLRKEGEPSMSLQSMKAQPKYESPELESQQ
EQVLDVETGNEYGNLKQEVSEEMEPHGKTSSKFENDMSKSARCGETREPEEITEEPSACS
REDKQPTCDENGVSLTENSDHTEHQRICPGEESYGCDDCGKAFSQHSHLIEHQRIHTGDR
PYKCEECGKAFRGRTVLIRHKIIHTGEKPYKCNECGKAFGRWSALNQHQRLHTGEKHYHC
NDCGKAFSQKAGLFHHIKIHTRDKPYQCTQCNKSFSRRSILTQHQGVHTGAKPYECNECG
KAFVYNSSLVSHQEIHHKEKCYQCKECGKSFSQSGLIQHQRIHTGEKPYKCDVCEKAFIQ
RTSLTEHQRIHTGERPYKCDKCGKAFTQRSVLTEHQRIHTGERPYKCDECGNAFRGITSL
IQHQRIHTGEKPYQCDECGKAFRQRKKTSYKEILLKNHSEPQAGVNLLLSSLIPEWQSCF
RRDL
Download sequence
Identical sequences A0A024RCI2 O43309
9606.ENSP00000380039 ENSP00000354305 ENSP00000380039 ENSP00000354305 ENSP00000380039 ENSP00000354305

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]