SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000354458 from Homo sapiens 69_37

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000354458
Domain Number 1 Region: 539-584
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.000000000209
Family TSP-1 type 1 repeat 0.00081
Further Details:      
 
Domain Number 2 Region: 74-142,193-206,492-530
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.00000298
Family Growth factor receptor domain 0.016
Further Details:      
 
Domain Number 3 Region: 37-84
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.0000116
Family TSP-1 type 1 repeat 0.0036
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000354458   Gene: ENSG00000157131   Transcript: ENST00000361249
Sequence length 584
Comment pep:known chromosome:GRCh37:1:57320479:57383894:1 gene:ENSG00000157131 transcript:ENST00000361249 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MFAVVFFILSLMTCQPGVTAQEKVNQRVRRAATPAAVTCQLSNWSEWTDCFPCQDKKYRH
RSLLQPNKFGGTICSGDIWDQASCSSSTTCVRQAQCGQDFQCKETGRCLKRHLVCNGDQD
CLDGSDEDDCEDVRAIDEDCSQYEPIPGSQKAALGYNILTQEDAQSVYDASYYGGQCETV
YNGEWRELRYDSTCERLYYGDDEKYFRKPYNFLKYHFEALADTGISSEFYDNANDLLSKV
KKDKSDSFGVTIGIGPAGSPLLVGVGVSHSQDTSFLNELNKYNEKKFIFTRIFTKVQTAH
FKMRKDDIMLDEGMLQSLMELPDQYNYGMYAKFINDYGTHYITSGSMGGIYEYILVIDKA
KMESLGITSRDITTCFGGSLGIQYEDKINVGGGLSGDHCKKFGGGKTERARKAMAVEDII
SRVRGGSSGWSGGLAQNRSTITYRSWGRSLKYNPVVIDFEMQPIHEVLRHTSLGPLEAKR
QNLRRALDQYLMEFNACRCGPCFNNGVPILEGTSCRCQCRLGSLGAACEQTQTEGAKADG
SWSCWSSWSVCRAGIQERRRECDNPAPQNGGASCPGRKVQTQAC
Download sequence
Identical sequences P07357
ENSP00000354458 NP_000553.1.87134 NP_000553.1.92137 ENSP00000354458 9606.ENSP00000354458 gi|4557389|ref|NP_000553.1| ENSP00000354458

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]