SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000355217 from Homo sapiens 69_37

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000355217
Domain Number 1 Region: 43-182
Classification Level Classification E-value
Superfamily PX domain 0.000000000000736
Family PX domain 0.01
Further Details:      
 
Domain Number 2 Region: 217-414
Classification Level Classification E-value
Superfamily BAR/IMD domain-like 0.000000129
Family BAR domain 0.048
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000355217   Gene: ENSG00000129515   Transcript: ENST00000362031
Sequence length 418
Comment pep:known chromosome:GRCh37:14:35031615:35099389:-1 gene:ENSG00000129515 transcript:ENST00000362031 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MRACAGPRLGAAMMEGLDDGPDFLSEEDRGLKAINVDLQSDAALQVDISDALSERDKVKF
TVHTKSSLPNFKQNEFSVVRQHEEFIWLHDSFVENEDYAGYIIPPAPPRPDFDASREKLQ
KLGEGEGSMTKEEFTKMKQELEAEYLAIFKKTVAMHEVFLCRVAAHPILRRDLNFHVFLE
YNQDLSVRGKNKKEKLEDFFKNMVKSADGVIVSGVKDVDDFFEHERTFLLEYHNRVKDAS
AKSDRMTRSHKSAADDYNRIGSSLYALGTQDSTDICKFFLKVSELFDKTRKIEARVSADE
DLKLSDLLKYYLRESQAAKDLLYRRSRSLVDYENANKALDKARAKNKDVLQAETSQQLCC
QKFEKISESAKQELIDFKTRRVAAFRKNLVELAELELKHAKGNLQLLQNCLAVLNGDT
Download sequence
Identical sequences A0A0A0MRI2
ENSP00000355217 NP_689419.2.87134 NP_689419.2.92137 9606.ENSP00000355217 ENSP00000355217 ENSP00000355217 gi|88703041|ref|NP_689419.2|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]