SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000355454 from Homo sapiens 69_37

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000355454
Domain Number 1 Region: 37-126
Classification Level Classification E-value
Superfamily Retrovirus capsid dimerization domain-like 3.34e-36
Family SCAN domain 0.0000671
Further Details:      
 
Domain Number 2 Region: 469-521
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000000000153
Family Classic zinc finger, C2H2 0.0041
Further Details:      
 
Domain Number 3 Region: 437-481
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000000431
Family Classic zinc finger, C2H2 0.013
Further Details:      
 
Domain Number 4 Region: 558-611
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000524
Family Classic zinc finger, C2H2 0.0075
Further Details:      
 
Domain Number 5 Region: 256-300
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 0.00000017
Family KRAB domain (Kruppel-associated box) 0.004
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000355454   Gene: ENSG00000162714   Transcript: ENST00000366498
Sequence length 623
Comment pep:known chromosome:GRCh37:1:247463623:247495045:-1 gene:ENSG00000162714 transcript:ENST00000366498 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPTALCPRVLAPKESEEPRKMRSPPGENPSPQGELPSPESSRRLFRRFRYQEAAGPREAL
QRLWDLCGGWLRPERHTKEQILELLVLEQFLAILPREIQSWVRAQEPESGEQAVAAVEAL
EREPGRPWQWLKHCEDPVVIDDGDSPLDQEQEQLPVEPHSDLAKNQDAQPITLAQCLGLP
SRPPSQLSGDPVLQDAFLLQEENVRDTQQVTTLQLPPRIFQFNNHRSNGYILEMLGSGGK
KAQIISVLSQIYVSRVSPFKDMILCFSEEDWSLLDPAQTGFYGEFIIGEDYGVSMPPNDL
AAQPDLSQGEENEPRVPELQDLQGKEVPQVSYLDSPSLQPFQVEERRKREELQVPEFQAC
PQTVVPQNTYPAGGNPRSLENSLDEEVTIEIVLSSSGDEDSQHGPYCTEELGSPTEKQRS
LPASHRSSTEAGGEVQTSKKSYVCPNCGKIFRWRVNFIRHLRSRREQEKPHECSVCGELF
SDSEDLDGHLESHEAQKPYRCGACGKSFRLNSHLLSHRRIHLQPDRLQPVEKREQAASED
ADKGPKEPLENGKAKLSFQCCECGKAFQRHDHLARHRSHFHLKDKARPFQCRYCVKSFTQ
NYDLLRHERLHMKRRSKQALNSY
Download sequence
Identical sequences ENSP00000355454 ENSP00000355454 XP_005273385.1.92137

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]