SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000355537 from Homo sapiens 69_37

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000355537
Domain Number 1 Region: 15-256
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 1.46e-87
Family Calponin-homology domain, CH-domain 0.0000251
Further Details:      
 
Domain Number 2 Region: 274-396
Classification Level Classification E-value
Superfamily Spectrin repeat 2.22e-34
Family Spectrin repeat 0.000000247
Further Details:      
 
Domain Number 3 Region: 510-631
Classification Level Classification E-value
Superfamily Spectrin repeat 1.83e-32
Family Spectrin repeat 0.000000463
Further Details:      
 
Domain Number 4 Region: 391-506
Classification Level Classification E-value
Superfamily Spectrin repeat 7.85e-24
Family Spectrin repeat 0.000000481
Further Details:      
 
Domain Number 5 Region: 635-746
Classification Level Classification E-value
Superfamily Spectrin repeat 1.27e-22
Family Spectrin repeat 0.000000565
Further Details:      
 
Domain Number 6 Region: 739-867
Classification Level Classification E-value
Superfamily EF-hand 4.03e-22
Family EF-hand modules in multidomain proteins 0.0016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000355537   Gene: ENSG00000077522   Transcript: ENST00000366578
Sequence length 894
Comment pep:known chromosome:GRCh37:1:236849808:236927931:1 gene:ENSG00000077522 transcript:ENST00000366578 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MNQIEPGVQYNYVYDEDEYMIQEEEWDRDLLLDPAWEKQQRKTFTAWCNSHLRKAGTQIE
NIEEDFRNGLKLMLLLEVISGERLPKPDRGKMRFHKIANVNKALDYIASKGVKLVSIGAE
EIVDGNVKMTLGMIWTIILRFAIQDISVEETSAKEGLLLWCQRKTAPYRNVNIQNFHTSW
KDGLGLCALIHRHRPDLIDYSKLNKDDPIGNINLAMEIAEKHLDIPKMLDAEDIVNTPKP
DERAIMTYVSCFYHAFAGAEQAETAANRICKVLAVNQENERLMEEYERLASELLEWIRRT
IPWLENRTPEKTMQAMQKKLEDFRDYRRKHKPPKVQEKCQLEINFNTLQTKLRISNRPAF
MPSEGKMVSDIAGAWQRLEQAEKGYEEWLLNEIRRLERLEHLAEKFRQKASTHETWAYGK
EQILLQKDYESASLTEVRALLRKHEAFESDLAAHQDRVEQIAAIAQELNELDYHDAVNVN
DRCQKICDQWDRLGTLTQKRREALERMEKLLETIDQLHLEFAKRAAPFNNWMEGAMEDLQ
DMFIVHSIEEIQSLITAHEQFKATLPEADGERQSIMAIQNEVEKVIQSYNIRISSSNPYS
TVTMDELRTKWDKVKQLVPIRDQSLQEELARQHANERLRRQFAAQANAIGPWIQNKMEEI
ARSSIQITGALEDQMNQLKQYEHNIINYKNNIDKLEGDHQLIQEALVFDNKHTNYTMEHI
RVGWELLLTTIARTINEVETQILTRDAKGITQEQMNEFRASFNHFDRRKNGLMDHEDFRA
CLISMGYDLGEAEFARIMTLVDPNGQGTVTFQSFIDFMTRETADTDTAEQVIASFRILAS
DKPYILAEELRRELPPDQAQYCIKRMPAYSGPGSVPGALDYAAFSSALYGESDL
Download sequence
Identical sequences P35609
gi|4501893|ref|NP_001094.1| NP_001094.1.87134 NP_001094.1.92137 ENSP00000355537 ENSP00000355537 9606.ENSP00000355537 ENSP00000355537

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]